Sturnira hondurensis: 119000535 Help Entry 119000535         CDS       T07222                                  Symbol IL18 Name (RefSeq) interleukin-18   KO K05482   interleukin 18 Organism shon  Sturnira hondurensis Pathway shon04060   Cytokine-cytokine receptor interaction shon04061   Viral protein interaction with cytokine and cytokine receptor shon04621   NOD-like receptor signaling pathway shon04623   Cytosolic DNA-sensing pathway shon05132   Salmonella infection shon05134   Legionellosis shon05135   Yersinia infection shon05143   African trypanosomiasis shon05144   Malaria shon05152   Tuberculosis shon05164   Influenza A shon05321   Inflammatory bowel disease shon05323   Rheumatoid arthritis shon05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:shon00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     119000535 (IL18)    04061 Viral protein interaction with cytokine and cytokine receptor     119000535 (IL18)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     119000535 (IL18)    04623 Cytosolic DNA-sensing pathway     119000535 (IL18)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     119000535 (IL18)   09171 Infectious disease: bacterial    05132 Salmonella infection     119000535 (IL18)    05135 Yersinia infection     119000535 (IL18)    05134 Legionellosis     119000535 (IL18)    05152 Tuberculosis     119000535 (IL18)   09174 Infectious disease: parasitic    05144 Malaria     119000535 (IL18)    05143 African trypanosomiasis     119000535 (IL18)   09163 Immune disease    05323 Rheumatoid arthritis     119000535 (IL18)    05321 Inflammatory bowel disease     119000535 (IL18)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     119000535 (IL18)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shon04052]     119000535 (IL18) Cytokines and neuropeptides [BR:shon04052]  Cytokines   Interleukins    119000535 (IL18) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1 Motif Other DBs NCBI-GeneID:  119000535 NCBI-ProteinID:  XP_036921485 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAELLEDNCINFVEMKFIDNTLYFVAEDDENLESDYFGKLESRLSIIRNINNQVLFISP EDQPVFEDMTDADCEGNAPRTEIIMFMYKDSFPRGMAVTISVKCNKMFTLSCKNKSVSFK EMIPPDSINDEGNDIIFFMRRVPGHHNKMQFESSLYKEHFLACKKENDLFKLILKEKDKY GDDSVMFTVQSKN NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgctgaactactagaagacaattgcatcaactttgtggaaatgaaatttattgac aacacactttactttgtagctgaagatgatgaaaacctggaatcagattactttggcaaa ctcgaatctagattgtcaatcatacgaaatataaacaaccaagttctcttcatttcacca gaagaccaacctgtgtttgaagatatgactgatgctgactgtgaaggtaatgcaccccga actgaaatcatcatgtttatgtataaagacagcttccctcgaggcatggcagtaacaatc tctgtgaagtgtaataaaatgtttactctctcctgtaagaacaaaagcgtttcctttaag gaaatgattcctcctgatagtatcaatgatgaaggaaatgacatcatattctttatgaga agagttccaggacatcacaataagatgcaatttgagtcttcattatacaaagagcacttt ctagcttgtaaaaaggagaatgatcttttcaaactcattttgaaagaaaaggacaaatat ggggatgattctgtaatgttcactgttcaaagcaagaactag

DBGET integrated database retrieval system