Sarcophilus harrisii (Tasmanian devil): 100914681 Help Entry 100914681         CDS       T02286                                  Symbol IL4 Name (RefSeq) interleukin-4   KO K05430   interleukin 4 Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr04060   Cytokine-cytokine receptor interaction shr04151   PI3K-Akt signaling pathway shr04630   JAK-STAT signaling pathway shr04640   Hematopoietic cell lineage shr04657   IL-17 signaling pathway shr04658   Th1 and Th2 cell differentiation shr04659   Th17 cell differentiation shr04660   T cell receptor signaling pathway shr04664   Fc epsilon RI signaling pathway shr04672   Intestinal immune network for IgA production shr05140   Leishmaniasis shr05200   Pathways in cancer shr05310   Asthma shr05320   Autoimmune thyroid disease shr05321   Inflammatory bowel disease shr05330   Allograft rejection Brite KEGG Orthology (KO) [BR:shr00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100914681 (IL4)    04151 PI3K-Akt signaling pathway     100914681 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100914681 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100914681 (IL4)    04660 T cell receptor signaling pathway     100914681 (IL4)    04658 Th1 and Th2 cell differentiation     100914681 (IL4)    04659 Th17 cell differentiation     100914681 (IL4)    04657 IL-17 signaling pathway     100914681 (IL4)    04664 Fc epsilon RI signaling pathway     100914681 (IL4)    04672 Intestinal immune network for IgA production     100914681 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100914681 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     100914681 (IL4)   09163 Immune disease    05310 Asthma     100914681 (IL4)    05320 Autoimmune thyroid disease     100914681 (IL4)    05321 Inflammatory bowel disease     100914681 (IL4)    05330 Allograft rejection     100914681 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shr04052]     100914681 (IL4)    00536 Glycosaminoglycan binding proteins [BR:shr00536]     100914681 (IL4) Cytokines and neuropeptides [BR:shr04052]  Cytokines   Interleukins    100914681 (IL4) Glycosaminoglycan binding proteins [BR:shr00536]  Heparan sulfate / Heparin   Cytokines    100914681 (IL4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL4 MitMem_reg IL13 DUF7514 ARM_ECM29_C Motif Other DBs NCBI-GeneID:  100914681 NCBI-ProteinID:  XP_003756539 Ensembl:  ENSSHAG00000011839 LinkDB All DBs Position 2:351398514..351405424 Genome browser AA seq 156 aa AA seqDB search MGLTFQLIPTLFCLLTCTSGVVHGQRRNCRSTVREIILSASSLTTKKFLCSEMEVLDIFE DTKNSSTRKLLPEMSSCSQLAMTVNDFETLCRAVTVLQQASNSCPRQELKKMCRNLMHLV NQTKCPVNETKITKLQDFLSKLKTINQKIFSKSTQF NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atgggtctcacattccaactgataccaactttgttctgcctgttaacatgtactagtggt gttgtccacggacagagaagaaactgccgaagcacggttagagagatcatcctctctgcg agctctctcaccacgaaaaagtttctctgctctgagatggaagtgctagacatctttgag gatacaaagaattccagtactcgaaagttgttacctgagatgtcctcatgttctcagctg gccatgacagtgaatgactttgaaacactatgcagagctgtcactgtgcttcaacaggcc tccaacagctgtccaagacaagagctaaagaaaatgtgtagaaacctaatgcatttagtg aatcagaccaaatgtcctgtgaatgaaaccaagattactaaattgcaagatttcctgagc aaactaaaaaccatcaatcagaagatattttcaaaaagcacacaattttag

DBGET integrated database retrieval system