Sarcophilus harrisii (Tasmanian devil): 100919051 Help Entry 100919051         CDS       T02286                                  Symbol ACTB Name (RefSeq) actin, cytoplasmic 1   KO K05692   actin beta/gamma 1 Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr03082   ATP-dependent chromatin remodeling shr04015   Rap1 signaling pathway shr04145   Phagosome shr04210   Apoptosis shr04390   Hippo signaling pathway shr04510   Focal adhesion shr04520   Adherens junction shr04530   Tight junction shr04611   Platelet activation shr04613   Neutrophil extracellular trap formation shr04670   Leukocyte transendothelial migration shr04714   Thermogenesis shr04810   Regulation of actin cytoskeleton shr04814   Motor proteins shr04820   Cytoskeleton in muscle cells shr04919   Thyroid hormone signaling pathway shr04921   Oxytocin signaling pathway shr04971   Gastric acid secretion shr05014   Amyotrophic lateral sclerosis shr05100   Bacterial invasion of epithelial cells shr05132   Salmonella infection shr05135   Yersinia infection shr05164   Influenza A shr05205   Proteoglycans in cancer shr05225   Hepatocellular carcinoma shr05410   Hypertrophic cardiomyopathy shr05412   Arrhythmogenic right ventricular cardiomyopathy shr05414   Dilated cardiomyopathy shr05416   Viral myocarditis shr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:shr00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     100919051 (ACTB)  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100919051 (ACTB)    04390 Hippo signaling pathway     100919051 (ACTB)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     100919051 (ACTB)   09143 Cell growth and death    04210 Apoptosis     100919051 (ACTB)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100919051 (ACTB)    04520 Adherens junction     100919051 (ACTB)    04530 Tight junction     100919051 (ACTB)   09142 Cell motility    04814 Motor proteins     100919051 (ACTB)    04820 Cytoskeleton in muscle cells     100919051 (ACTB)    04810 Regulation of actin cytoskeleton     100919051 (ACTB)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100919051 (ACTB)    04613 Neutrophil extracellular trap formation     100919051 (ACTB)    04670 Leukocyte transendothelial migration     100919051 (ACTB)   09152 Endocrine system    04921 Oxytocin signaling pathway     100919051 (ACTB)    04919 Thyroid hormone signaling pathway     100919051 (ACTB)   09154 Digestive system    04971 Gastric acid secretion     100919051 (ACTB)   09159 Environmental adaptation    04714 Thermogenesis     100919051 (ACTB)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100919051 (ACTB)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     100919051 (ACTB)   09172 Infectious disease: viral    05164 Influenza A     100919051 (ACTB)   09171 Infectious disease: bacterial    05132 Salmonella infection     100919051 (ACTB)    05135 Yersinia infection     100919051 (ACTB)    05100 Bacterial invasion of epithelial cells     100919051 (ACTB)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100919051 (ACTB)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100919051 (ACTB)    05410 Hypertrophic cardiomyopathy     100919051 (ACTB)    05412 Arrhythmogenic right ventricular cardiomyopathy     100919051 (ACTB)    05414 Dilated cardiomyopathy     100919051 (ACTB)    05416 Viral myocarditis     100919051 (ACTB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:shr03021]     100919051 (ACTB)    03019 Messenger RNA biogenesis [BR:shr03019]     100919051 (ACTB)    03036 Chromosome and associated proteins [BR:shr03036]     100919051 (ACTB)    03029 Mitochondrial biogenesis [BR:shr03029]     100919051 (ACTB)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:shr04812]     100919051 (ACTB)    04147 Exosome [BR:shr04147]     100919051 (ACTB) Transcription machinery [BR:shr03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      100919051 (ACTB) Messenger RNA biogenesis [BR:shr03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      100919051 (ACTB) Chromosome and associated proteins [BR:shr03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      100919051 (ACTB)     NuA4 complex      100919051 (ACTB)   Chromatin remodeling factors    BAF complex     100919051 (ACTB)    PBAF complex     100919051 (ACTB)    GBAF(ncBAF) complex     100919051 (ACTB)    SWR1 complex     100919051 (ACTB) Mitochondrial biogenesis [BR:shr03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     100919051 (ACTB) Cytoskeleton proteins [BR:shr04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      100919051 (ACTB) Exosome [BR:shr04147]  Exosomal proteins   Proteins found in most exosomes    100919051 (ACTB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  100919051 NCBI-ProteinID:  XP_003761602 Ensembl:  ENSSHAG00000012694 UniProt:  A0A7N4PW14 LinkDB All DBs Position 1:255925351..255930615 Genome browser AA seq 375 aa AA seqDB search MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt atggatgatgatattgctgctctcgttgttgacaatggctccggaatgtgcaaagctggc tttgcaggagacgatgcccctcgggctgtgttcccttccattgttgggcgccccagacat cagggtgtaatggtgggcatgggccagaaagatagctatgtgggggatgaagcccagagc aagagaggtattctgaccctgaagtatcccattgaacacggtattgtcaccaactgggat gacatggagaagatctggcatcacactttctacaatgagctccgtgtggcccctgaggag caccctgtgctgctcacagaagctcccctgaaccccaaagccaacagagaaaagatgact cagattatgtttgagaccttcaacaccccagccatgtacgttgccatccaggctgtgctg tccctgtatgcctctggtcgtaccactggtattgtgatggactccggtgatggtgtgacc cacactgtgcccatctatgaaggttatgcccttccccatgccatcctccgtctggatctg gctggccgtgatctgacggactacctcatgaagatcctgactgagagagggtacagcttc actactacagctgagagggaaatcgtacgtgacatcaaggagaagctgtgctacgtcgcc ctagactttgaacaggagatggccactgctgcatctagctcctctctggaaaagagctat gagcttcctgatggtcaggttatcaccattggcaatgagcggttccgatgcccagaagct ctcttccaaccatctttcttaggtatggaatcctgtggaatccacgaaactaccttcaac tccatcatgaagtgtgatgttgacatccgtaaggatctgtatgctaacaccgtattgtct ggtggtaccaccatgtacccaggcattgctgacaggatgcaaaaggagattacagcccta gcccccagcacaatgaaaatcaagatcattgccccacctgagcgcaaatactctgtctgg attggaggctccatcctggcctctctttccaccttccagcagatgtggatcagcaagcag gagtatgatgaatctgggccctccattgtccaccgcaaatgcttctaa

DBGET integrated database retrieval system