Sarcophilus harrisii (Tasmanian devil): 100923807 Help Entry 100923807         CDS       T02286                                  Name (RefSeq) actin, cytoplasmic type 5   KO K05692   actin beta/gamma 1 Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr03082   ATP-dependent chromatin remodeling shr04015   Rap1 signaling pathway shr04145   Phagosome shr04210   Apoptosis shr04390   Hippo signaling pathway shr04510   Focal adhesion shr04520   Adherens junction shr04530   Tight junction shr04611   Platelet activation shr04613   Neutrophil extracellular trap formation shr04670   Leukocyte transendothelial migration shr04714   Thermogenesis shr04810   Regulation of actin cytoskeleton shr04814   Motor proteins shr04820   Cytoskeleton in muscle cells shr04919   Thyroid hormone signaling pathway shr04921   Oxytocin signaling pathway shr04971   Gastric acid secretion shr05014   Amyotrophic lateral sclerosis shr05100   Bacterial invasion of epithelial cells shr05132   Salmonella infection shr05135   Yersinia infection shr05164   Influenza A shr05205   Proteoglycans in cancer shr05225   Hepatocellular carcinoma shr05410   Hypertrophic cardiomyopathy shr05412   Arrhythmogenic right ventricular cardiomyopathy shr05414   Dilated cardiomyopathy shr05416   Viral myocarditis shr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:shr00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     100923807  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100923807    04390 Hippo signaling pathway     100923807  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     100923807   09143 Cell growth and death    04210 Apoptosis     100923807   09144 Cellular community - eukaryotes    04510 Focal adhesion     100923807    04520 Adherens junction     100923807    04530 Tight junction     100923807   09142 Cell motility    04814 Motor proteins     100923807    04820 Cytoskeleton in muscle cells     100923807    04810 Regulation of actin cytoskeleton     100923807  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100923807    04613 Neutrophil extracellular trap formation     100923807    04670 Leukocyte transendothelial migration     100923807   09152 Endocrine system    04921 Oxytocin signaling pathway     100923807    04919 Thyroid hormone signaling pathway     100923807   09154 Digestive system    04971 Gastric acid secretion     100923807   09159 Environmental adaptation    04714 Thermogenesis     100923807  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100923807   09162 Cancer: specific types    05225 Hepatocellular carcinoma     100923807   09172 Infectious disease: viral    05164 Influenza A     100923807   09171 Infectious disease: bacterial    05132 Salmonella infection     100923807    05135 Yersinia infection     100923807    05100 Bacterial invasion of epithelial cells     100923807   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100923807   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100923807    05410 Hypertrophic cardiomyopathy     100923807    05412 Arrhythmogenic right ventricular cardiomyopathy     100923807    05414 Dilated cardiomyopathy     100923807    05416 Viral myocarditis     100923807  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:shr03021]     100923807    03019 Messenger RNA biogenesis [BR:shr03019]     100923807    03036 Chromosome and associated proteins [BR:shr03036]     100923807    03029 Mitochondrial biogenesis [BR:shr03029]     100923807   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:shr04812]     100923807    04147 Exosome [BR:shr04147]     100923807 Transcription machinery [BR:shr03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      100923807 Messenger RNA biogenesis [BR:shr03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      100923807 Chromosome and associated proteins [BR:shr03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      100923807     NuA4 complex      100923807   Chromatin remodeling factors    BAF complex     100923807    PBAF complex     100923807    GBAF(ncBAF) complex     100923807    SWR1 complex     100923807 Mitochondrial biogenesis [BR:shr03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     100923807 Cytoskeleton proteins [BR:shr04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      100923807 Exosome [BR:shr04147]  Exosomal proteins   Proteins found in most exosomes    100923807 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  100923807 NCBI-ProteinID:  XP_031812478 Ensembl:  ENSSHAG00000014591 UniProt:  A0A7N4PS33 LinkDB All DBs Position 2:617517434..617519544 Genome browser AA seq 376 aa AA seqDB search MADEEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLD LAGRDLTDYLMKILTERGYSFTTTAEREIVRDVKEKLCYVALDFEQEMATAASSSSLEKS YELPDGQVITIGNERFRCPESIFQPSFLGMESCGIHETTYNSIMKCDVDIRKDLYANTVL SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK QEYDESGPSIVHRKCF NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt atggctgatgaagaaatcgcggcgctggtggtggacaacggctcgggcatgtgcaaggcc ggcttcgccggagacgacgcgccgcgggccgtgttcccttccatcgtgggccgcccccgg caccagggcgtcatggtgggcatgggccagaaggacagctacgtgggcgacgaggcccag agcaaaaggggcatcctgaccctcaagtaccccatcgagcacggcatcgtcaccaactgg gacgacatggagaagatctggcaccacaccttctacaacgagctccgagtggcccccgag gagcaccctgtgctgctgaccgaggcgcctctgaatcccaaggccaacagggagaagatg acccagatcatgttcgagaccttcaacacccccgccatgtacgtggccatccaggccgtg ctgtctctctacgcttctggccgcaccacggggatcgtgatggactccggggacggcgtc acccacaccgttcccatctacgaagggtacgctctcccccacgccatcctgcggcttgac ctggccgggcgcgacctcaccgactacctcatgaagattttgaccgaaagaggctacagc ttcaccaccacggccgagagggagatcgtgagggatgtcaaagagaagctgtgttatgtt gccctggacttcgagcaagagatggccaccgcggcttcttcctcctccctggagaagagc tacgagctccctgatggtcaagtcatcaccatcggcaatgagaggttccgatgcccagaa tctatcttccagccttctttcctgggaatggagtcctgcgggatccacgagaccacctac aattccattatgaagtgtgatgtggacatccggaaggatctctacgctaatacggtgttg tctggcggtaccaccatgtatcctggcattgctgacagaatgcagaaggagatcacagcc ctggctccaagcacaatgaaaataaaaatcattgccccacctgaacgcaaatactccgtc tggattggaggttccatcctggcctctctctctaccttccagcagatgtggatcagcaag caggaatatgatgaatctggtccttctattgtccaccggaaatgcttttaa

DBGET integrated database retrieval system