Sarcophilus harrisii (Tasmanian devil): 100924435 Help Entry 100924435         CDS       T02286                                  Symbol FOS Name (RefSeq) proto-oncogene c-Fos   KO K04379   proto-oncogene protein c-fos Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr01522   Endocrine resistance shr04010   MAPK signaling pathway shr04024   cAMP signaling pathway shr04210   Apoptosis shr04380   Osteoclast differentiation shr04620   Toll-like receptor signaling pathway shr04657   IL-17 signaling pathway shr04658   Th1 and Th2 cell differentiation shr04659   Th17 cell differentiation shr04660   T cell receptor signaling pathway shr04662   B cell receptor signaling pathway shr04668   TNF signaling pathway shr04713   Circadian entrainment shr04725   Cholinergic synapse shr04728   Dopaminergic synapse shr04915   Estrogen signaling pathway shr04917   Prolactin signaling pathway shr04921   Oxytocin signaling pathway shr04926   Relaxin signaling pathway shr04928   Parathyroid hormone synthesis, secretion and action shr04932   Non-alcoholic fatty liver disease shr04935   Growth hormone synthesis, secretion and action shr05031   Amphetamine addiction shr05132   Salmonella infection shr05133   Pertussis shr05135   Yersinia infection shr05140   Leishmaniasis shr05142   Chagas disease shr05161   Hepatitis B shr05162   Measles shr05166   Human T-cell leukemia virus 1 infection shr05167   Kaposi sarcoma-associated herpesvirus infection shr05170   Human immunodeficiency virus 1 infection shr05171   Coronavirus disease shr05200   Pathways in cancer shr05207   Chemical carcinogenesis - receptor activation shr05208   Chemical carcinogenesis - reactive oxygen species shr05210   Colorectal cancer shr05224   Breast cancer shr05231   Choline metabolism in cancer shr05235   PD-L1 expression and PD-1 checkpoint pathway in cancer shr05323   Rheumatoid arthritis shr05417   Lipid and atherosclerosis shr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:shr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100924435 (FOS)    04668 TNF signaling pathway     100924435 (FOS)    04024 cAMP signaling pathway     100924435 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     100924435 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100924435 (FOS)    04660 T cell receptor signaling pathway     100924435 (FOS)    04658 Th1 and Th2 cell differentiation     100924435 (FOS)    04659 Th17 cell differentiation     100924435 (FOS)    04657 IL-17 signaling pathway     100924435 (FOS)    04662 B cell receptor signaling pathway     100924435 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     100924435 (FOS)    04917 Prolactin signaling pathway     100924435 (FOS)    04921 Oxytocin signaling pathway     100924435 (FOS)    04926 Relaxin signaling pathway     100924435 (FOS)    04935 Growth hormone synthesis, secretion and action     100924435 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     100924435 (FOS)   09156 Nervous system    04725 Cholinergic synapse     100924435 (FOS)    04728 Dopaminergic synapse     100924435 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     100924435 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     100924435 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100924435 (FOS)    05207 Chemical carcinogenesis - receptor activation     100924435 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     100924435 (FOS)    05231 Choline metabolism in cancer     100924435 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100924435 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     100924435 (FOS)    05224 Breast cancer     100924435 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100924435 (FOS)    05170 Human immunodeficiency virus 1 infection     100924435 (FOS)    05161 Hepatitis B     100924435 (FOS)    05171 Coronavirus disease     100924435 (FOS)    05162 Measles     100924435 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     100924435 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     100924435 (FOS)    05135 Yersinia infection     100924435 (FOS)    05133 Pertussis     100924435 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     100924435 (FOS)    05142 Chagas disease     100924435 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     100924435 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     100924435 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100924435 (FOS)    05418 Fluid shear stress and atherosclerosis     100924435 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100924435 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     100924435 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:shr03000]     100924435 (FOS)    04131 Membrane trafficking [BR:shr04131]     100924435 (FOS) Transcription factors [BR:shr03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     100924435 (FOS) Membrane trafficking [BR:shr04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     100924435 (FOS) SSDB OrthologParalogGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf CCDC110 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  100924435 NCBI-ProteinID:  XP_003756267 Ensembl:  ENSSHAG00000017780 LinkDB All DBs Position 2:complement(305122495..305126139) Genome browser AA seq 378 aa AA seqDB search MMYQGFNAEYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNSQDFCTDLSVSSANF IPTVTAISTSPDLQWLVQPTLISSVAPSQTRVHPYGVSTPSAAVYSRAGIVKTAGGRGQS IGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTE IANLLKEKEKLEFILAAHRPACKIPDDLGFPEEITAASLDLTGGLNEATTPESEEAFSLP LLQEPEPKPSVEPVKNINSLELKAEPFDDFLFPASSRPSGLESAARSVPDMDLAGSFYAA DWEPLHSSSLGMGVAADLEPLCTPVVTCTPTCTTYTSSFVFTYPEADSFPSCAAAHRKGS SSNEPSSDSLSSPTLLAL NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt atgatgtaccaaggattcaatgccgaatacgaagcatcctcctcccgatgcagcagtgct tccccggctggggacagcctctcttattatcactccccggctgactccttttccagcatg ggctctcctgtcaactcacaggatttctgcacagatctgtctgtttccagtgccaacttt ataccgactgtgacggctatatcgacaagcccagacctgcagtggttggttcagcccacc ctcatctcttctgtagccccatcccagaccagagtccatccttatggagtctctactcct tcagctgctgtttactctagggctggtattgtgaagactgcaggaggccgagggcaaagc attggcaggaggggcaaagttgaacagctttccccagaagaagaggagaaaagaaggatc agaagggaaaggaacaagatggctgcagccaaatgtcgtaacagaaggcgagaactgact gacacactccaagcggagacagaccaactagaagatgaaaaatctgctttacaaactgag atagccaatctgctgaaggagaaggaaaagcttgaattcatcctggcagcccatcgacct gcctgcaagattcctgatgacttgggctttccagaagaaataacagctgcctcccttgac ctcactggtggtctgaatgaggctacaaccccagaatcagaggaagccttctccttgccc ctcttgcaggagcctgaacccaaaccctctgtggagccagtcaagaatatcaacagtttg gagctgaaggctgaaccctttgatgatttcctcttcccagcttcctccaggcccagtggc ttagaatcggctgcgcggtcagtgcctgacatggacctggctggttccttctatgcagca gactgggagcctcttcacagcagctccttgggaatgggagtagcagctgacctagagcca ctgtgcactcctgtagtcacttgcacgcctacctgcaccacctatacatcttccttcgtc ttcacctacccagaagctgattccttccccagctgtgcagcggctcaccggaagggaagc agcagcaatgagccctcttctgactcactcagctccccaactctgctggctttgtga

DBGET integrated database retrieval system