Sarcophilus harrisii (Tasmanian devil): 100932899 Help Entry 100932899         CDS       T02286                                  Symbol CDK4 Name (RefSeq) cyclin-dependent kinase 4   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr01522   Endocrine resistance shr04110   Cell cycle shr04115   p53 signaling pathway shr04151   PI3K-Akt signaling pathway shr04218   Cellular senescence shr04530   Tight junction shr04660   T cell receptor signaling pathway shr04933   AGE-RAGE signaling pathway in diabetic complications shr04934   Cushing syndrome shr05160   Hepatitis C shr05162   Measles shr05163   Human cytomegalovirus infection shr05164   Influenza A shr05165   Human papillomavirus infection shr05166   Human T-cell leukemia virus 1 infection shr05167   Kaposi sarcoma-associated herpesvirus infection shr05169   Epstein-Barr virus infection shr05200   Pathways in cancer shr05203   Viral carcinogenesis shr05212   Pancreatic cancer shr05214   Glioma shr05218   Melanoma shr05219   Bladder cancer shr05220   Chronic myeloid leukemia shr05222   Small cell lung cancer shr05223   Non-small cell lung cancer shr05224   Breast cancer shr05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:shr00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     100932899 (CDK4)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     100932899 (CDK4)    04115 p53 signaling pathway     100932899 (CDK4)    04218 Cellular senescence     100932899 (CDK4)   09144 Cellular community - eukaryotes    04530 Tight junction     100932899 (CDK4)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     100932899 (CDK4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100932899 (CDK4)    05203 Viral carcinogenesis     100932899 (CDK4)   09162 Cancer: specific types    05212 Pancreatic cancer     100932899 (CDK4)    05225 Hepatocellular carcinoma     100932899 (CDK4)    05214 Glioma     100932899 (CDK4)    05220 Chronic myeloid leukemia     100932899 (CDK4)    05218 Melanoma     100932899 (CDK4)    05219 Bladder cancer     100932899 (CDK4)    05224 Breast cancer     100932899 (CDK4)    05222 Small cell lung cancer     100932899 (CDK4)    05223 Non-small cell lung cancer     100932899 (CDK4)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100932899 (CDK4)    05160 Hepatitis C     100932899 (CDK4)    05164 Influenza A     100932899 (CDK4)    05162 Measles     100932899 (CDK4)    05163 Human cytomegalovirus infection     100932899 (CDK4)    05167 Kaposi sarcoma-associated herpesvirus infection     100932899 (CDK4)    05169 Epstein-Barr virus infection     100932899 (CDK4)    05165 Human papillomavirus infection     100932899 (CDK4)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     100932899 (CDK4)    04934 Cushing syndrome     100932899 (CDK4)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     100932899 (CDK4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:shr01001]     100932899 (CDK4) Enzymes [BR:shr01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      100932899 (CDK4) Protein kinases [BR:shr01001]  Serine/threonine kinases: CMGC group   CDK family    100932899 (CDK4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kdo Haspin_kinase ABC1 Kinase-like Motif Other DBs NCBI-GeneID:  100932899 NCBI-ProteinID:  XP_031796919 Ensembl:  ENSSHAG00000009373 UniProt:  A0A7N4PHB9 LinkDB All DBs Position 5:82812006..82815008 Genome browser AA seq 304 aa AA seqDB search MDIPRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVKVPTGGGSGSGLPVSTVREVALL RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPLETIKDL MRQFLRGLDFLHANCIVHRDLKPENILVTSSGTVKLADFGLARIYSCQMALTPVVVTLWY RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLSKIFDLIGLPAEDDWPP DVSLPRGAFTPCSPQPLQSVVPELEGPGAQLLLEMLTFSPHKRISAFRALQHTYLQTAGE GSPE NT seq 915 nt NT seq  +upstreamnt  +downstreamnt atggacatccctcggtatgagccagtggccgaaattggtgtcggtgcctatgggacggtg tacaaagcgcgtgacccccacagcgggcacttcgtggcactcaagagcgtgaaagtgccc acaggcggcgggagtgggagcggcctgcctgtcagcacggtccgggaggtggctctcctt cggaggctggaggcatttgagcatcccaacgttgtccggctgatggacgtctgtgccact gcccgaactgaccgagagaccaaggtgactctggtgtttgaacacgtggaccaagacctg aggacgtatctggacaaagcccctccaccaggcctgcccttggagaccatcaaggatcta atgagacagttcttaagaggcctagactttcttcatgctaactgcattgtccaccgtgac ttgaagccagaaaacatacttgtgaccagtagtggaacggtcaagctggctgactttggc ttagctcggatctacagctgccagatggcactcacacctgtggtagtcactctctggtac cgggcccctgaggttctcctgcagtcaacatatgcaacacctgtggacatgtggagtgtt ggctgcatcttcgcagagatgttccgtagaaagcctctcttctgtggaaattctgaagct gaccagttaagcaaaatcttcgatctgattgggctcccagcagaagatgattggcctcct gatgtttctctgccccggggagcctttactccttgtagtccccagcctttacagtctgtt gtgcctgagctggagggacctggagcacagctgctactggaaatgctgacctttagccca cacaaacggatctctgccttccgagctcttcaacacacttacctacagacagctggggaa gggagccccgaatga

DBGET integrated database retrieval system