Sarcophilus harrisii (Tasmanian devil): 100934542 Help Entry 100934542         CDS       T02286                                  Symbol FGF2 Name (RefSeq) fibroblast growth factor 2   KO K18497   fibroblast growth factor 2 Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr01521   EGFR tyrosine kinase inhibitor resistance shr04010   MAPK signaling pathway shr04014   Ras signaling pathway shr04015   Rap1 signaling pathway shr04020   Calcium signaling pathway shr04151   PI3K-Akt signaling pathway shr04550   Signaling pathways regulating pluripotency of stem cells shr04810   Regulation of actin cytoskeleton shr05167   Kaposi sarcoma-associated herpesvirus infection shr05200   Pathways in cancer shr05205   Proteoglycans in cancer shr05207   Chemical carcinogenesis - receptor activation shr05218   Melanoma shr05224   Breast cancer shr05226   Gastric cancer Brite KEGG Orthology (KO) [BR:shr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100934542 (FGF2)    04014 Ras signaling pathway     100934542 (FGF2)    04015 Rap1 signaling pathway     100934542 (FGF2)    04020 Calcium signaling pathway     100934542 (FGF2)    04151 PI3K-Akt signaling pathway     100934542 (FGF2)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     100934542 (FGF2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100934542 (FGF2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100934542 (FGF2)    05205 Proteoglycans in cancer     100934542 (FGF2)    05207 Chemical carcinogenesis - receptor activation     100934542 (FGF2)   09162 Cancer: specific types    05226 Gastric cancer     100934542 (FGF2)    05218 Melanoma     100934542 (FGF2)    05224 Breast cancer     100934542 (FGF2)   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     100934542 (FGF2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100934542 (FGF2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shr04052]     100934542 (FGF2)    00536 Glycosaminoglycan binding proteins [BR:shr00536]     100934542 (FGF2) Cytokines and neuropeptides [BR:shr04052]  Cytokines   Growth factors (RTK binding)    100934542 (FGF2) Glycosaminoglycan binding proteins [BR:shr00536]  Heparan sulfate / Heparin   Growth factors/receptors    100934542 (FGF2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF IL1 Fascin Motif Other DBs NCBI-GeneID:  100934542 NCBI-ProteinID:  XP_031799398 LinkDB All DBs Position 6:complement(169724230..169791753) Genome browser AA seq 217 aa AA seqDB search MFLAGGRDYVSWAWGGRLGGRGQGGSQLAARLGGRGRGRAPLRLAARGTGAAAPGPSRSS GMAAGSITTLPALAGDGASGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGHVDGIREKSDP HIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLALKCVTEECFFFERLESNNYNTYRSR KYSNWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS NT seq 654 nt NT seq  +upstreamnt  +downstreamnt atgttcttagctggagggcgtgactatgtttcgtgggcctggggagggaggctggggggc cgcgggcagggcgggagccagctggccgctaggctggggggccgcgggaggggccgcgcc cctctgcggctggcagctcgggggaccggggccgcggcgccaggcccgtcccgcagcagc ggcatggccgcgggcagcatcaccacgttgccggccctggccggggatggagccagcggg ggcgcctttcccccgggccacttcaaggaccccaagcggctgtactgcaagaacggaggc ttcttcttgcgcatccatcccgacggtcacgtggacggcatccgcgagaagagcgatccg cacattaaacttcagcttcaggcagaagagagaggagtagtgtctattaaaggagtttgt gccaaccgctatcttgccatgaaagaggatggcagattactggctctgaaatgtgtgact gaagagtgtttcttctttgaacgtctagagtccaacaattacaacacttatcgctcaagg aaatactccaattggtatgtggcattgaaacgcacaggccagtataagcttggatccaag actggaccagggcagaaagccatccttttccttcccatgtctgctaagagctga

DBGET integrated database retrieval system