Sarcophilus harrisii (Tasmanian devil): 105750683 Help Entry 105750683         CDS       T02286                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr03050   Proteasome shr04060   Cytokine-cytokine receptor interaction shr04066   HIF-1 signaling pathway shr04217   Necroptosis shr04350   TGF-beta signaling pathway shr04380   Osteoclast differentiation shr04612   Antigen processing and presentation shr04630   JAK-STAT signaling pathway shr04650   Natural killer cell mediated cytotoxicity shr04657   IL-17 signaling pathway shr04658   Th1 and Th2 cell differentiation shr04659   Th17 cell differentiation shr04660   T cell receptor signaling pathway shr04940   Type I diabetes mellitus shr05140   Leishmaniasis shr05142   Chagas disease shr05143   African trypanosomiasis shr05144   Malaria shr05145   Toxoplasmosis shr05146   Amoebiasis shr05152   Tuberculosis shr05160   Hepatitis C shr05164   Influenza A shr05168   Herpes simplex virus 1 infection shr05200   Pathways in cancer shr05235   PD-L1 expression and PD-1 checkpoint pathway in cancer shr05321   Inflammatory bowel disease shr05322   Systemic lupus erythematosus shr05323   Rheumatoid arthritis shr05330   Allograft rejection shr05332   Graft-versus-host disease shr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:shr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     105750683 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     105750683 (IFNG)    04630 JAK-STAT signaling pathway     105750683 (IFNG)    04066 HIF-1 signaling pathway     105750683 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105750683 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     105750683 (IFNG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     105750683 (IFNG)    04612 Antigen processing and presentation     105750683 (IFNG)    04660 T cell receptor signaling pathway     105750683 (IFNG)    04658 Th1 and Th2 cell differentiation     105750683 (IFNG)    04659 Th17 cell differentiation     105750683 (IFNG)    04657 IL-17 signaling pathway     105750683 (IFNG)   09158 Development and regeneration    04380 Osteoclast differentiation     105750683 (IFNG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105750683 (IFNG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     105750683 (IFNG)   09172 Infectious disease: viral    05160 Hepatitis C     105750683 (IFNG)    05164 Influenza A     105750683 (IFNG)    05168 Herpes simplex virus 1 infection     105750683 (IFNG)   09171 Infectious disease: bacterial    05152 Tuberculosis     105750683 (IFNG)   09174 Infectious disease: parasitic    05146 Amoebiasis     105750683 (IFNG)    05144 Malaria     105750683 (IFNG)    05145 Toxoplasmosis     105750683 (IFNG)    05140 Leishmaniasis     105750683 (IFNG)    05142 Chagas disease     105750683 (IFNG)    05143 African trypanosomiasis     105750683 (IFNG)   09163 Immune disease    05322 Systemic lupus erythematosus     105750683 (IFNG)    05323 Rheumatoid arthritis     105750683 (IFNG)    05321 Inflammatory bowel disease     105750683 (IFNG)    05330 Allograft rejection     105750683 (IFNG)    05332 Graft-versus-host disease     105750683 (IFNG)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     105750683 (IFNG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     105750683 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:shr03051]     105750683 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shr04052]     105750683 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:shr00536]     105750683 (IFNG) Proteasome [BR:shr03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     105750683 (IFNG) Cytokines and neuropeptides [BR:shr04052]  Cytokines   Interferons    105750683 (IFNG) Glycosaminoglycan binding proteins [BR:shr00536]  Heparan sulfate / Heparin   Cytokines    105750683 (IFNG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IFN-gamma Tup_N Motif Other DBs NCBI-GeneID:  105750683 NCBI-ProteinID:  XP_012406108 Ensembl:  ENSSHAG00000015036 UniProt:  G3WQJ9 LinkDB All DBs Position 5:70862206..70867596 Genome browser AA seq 167 aa AA seqDB search MNYSSYLLASFLCVILSSSGCLSQVNLREDMQTLHNYFNATKSDVSDGSSLFMDMMKTWK EGNCDKKILMSHVVAVYFKIFEIFKNNSIVKRSMEHIREDMIMKLFPNNTASSVDDFEAL INTQVNDLKVQRKAMFELVYVFRNLSPKPHLTGRRRRQNKSQGKITQ NT seq 504 nt NT seq  +upstreamnt  +downstreamnt atgaattattcaagctacctcttagcatcctttctttgtgtcattctgagttcttctggc tgtctttctcaagttaacctaagagaagacatgcaaactcttcacaactactttaatgca actaaatctgacgtatcagatggtagttctctttttatggacatgatgaagacttggaaa gagggaaactgtgacaagaaaatcttaatgagccatgttgtcgcagtttatttcaaaatc ttcgaaatcttcaaaaacaactccattgtcaaaagaagtatggagcatatcagagaggat atgatcatgaaattatttcctaacaacactgccagctctgtggatgactttgaggcactc atcaatacccaggtgaatgacctcaaagtccaaaggaaagctatgtttgaactagtctat gttttccgtaacctctcaccgaaacctcatctaacagggagaagaagaagacagaacaaa agccaaggaaaaatcacacagtag

DBGET integrated database retrieval system