Sarcophilus harrisii (Tasmanian devil): 105750762 Help Entry 105750762         CDS       T02286                                  Symbol IL6 Name (RefSeq) interleukin-6   KO K05405   interleukin 6 Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr01521   EGFR tyrosine kinase inhibitor resistance shr01523   Antifolate resistance shr04060   Cytokine-cytokine receptor interaction shr04061   Viral protein interaction with cytokine and cytokine receptor shr04066   HIF-1 signaling pathway shr04068   FoxO signaling pathway shr04151   PI3K-Akt signaling pathway shr04218   Cellular senescence shr04620   Toll-like receptor signaling pathway shr04621   NOD-like receptor signaling pathway shr04623   Cytosolic DNA-sensing pathway shr04625   C-type lectin receptor signaling pathway shr04630   JAK-STAT signaling pathway shr04640   Hematopoietic cell lineage shr04657   IL-17 signaling pathway shr04659   Th17 cell differentiation shr04668   TNF signaling pathway shr04672   Intestinal immune network for IgA production shr04931   Insulin resistance shr04932   Non-alcoholic fatty liver disease shr04933   AGE-RAGE signaling pathway in diabetic complications shr04936   Alcoholic liver disease shr05010   Alzheimer disease shr05020   Prion disease shr05022   Pathways of neurodegeneration - multiple diseases shr05132   Salmonella infection shr05133   Pertussis shr05134   Legionellosis shr05135   Yersinia infection shr05142   Chagas disease shr05143   African trypanosomiasis shr05144   Malaria shr05146   Amoebiasis shr05152   Tuberculosis shr05161   Hepatitis B shr05162   Measles shr05163   Human cytomegalovirus infection shr05164   Influenza A shr05166   Human T-cell leukemia virus 1 infection shr05167   Kaposi sarcoma-associated herpesvirus infection shr05168   Herpes simplex virus 1 infection shr05169   Epstein-Barr virus infection shr05171   Coronavirus disease - COVID-19 shr05200   Pathways in cancer shr05202   Transcriptional misregulation in cancer shr05321   Inflammatory bowel disease shr05323   Rheumatoid arthritis shr05332   Graft-versus-host disease shr05410   Hypertrophic cardiomyopathy shr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:shr00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     105750762 (IL6)    04668 TNF signaling pathway     105750762 (IL6)    04066 HIF-1 signaling pathway     105750762 (IL6)    04068 FoxO signaling pathway     105750762 (IL6)    04151 PI3K-Akt signaling pathway     105750762 (IL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105750762 (IL6)    04061 Viral protein interaction with cytokine and cytokine receptor     105750762 (IL6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     105750762 (IL6)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     105750762 (IL6)    04620 Toll-like receptor signaling pathway     105750762 (IL6)    04621 NOD-like receptor signaling pathway     105750762 (IL6)    04623 Cytosolic DNA-sensing pathway     105750762 (IL6)    04625 C-type lectin receptor signaling pathway     105750762 (IL6)    04659 Th17 cell differentiation     105750762 (IL6)    04657 IL-17 signaling pathway     105750762 (IL6)    04672 Intestinal immune network for IgA production     105750762 (IL6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105750762 (IL6)    05202 Transcriptional misregulation in cancer     105750762 (IL6)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105750762 (IL6)    05161 Hepatitis B     105750762 (IL6)    05171 Coronavirus disease - COVID-19     105750762 (IL6)    05164 Influenza A     105750762 (IL6)    05162 Measles     105750762 (IL6)    05168 Herpes simplex virus 1 infection     105750762 (IL6)    05163 Human cytomegalovirus infection     105750762 (IL6)    05167 Kaposi sarcoma-associated herpesvirus infection     105750762 (IL6)    05169 Epstein-Barr virus infection     105750762 (IL6)   09171 Infectious disease: bacterial    05132 Salmonella infection     105750762 (IL6)    05135 Yersinia infection     105750762 (IL6)    05133 Pertussis     105750762 (IL6)    05134 Legionellosis     105750762 (IL6)    05152 Tuberculosis     105750762 (IL6)   09174 Infectious disease: parasitic    05146 Amoebiasis     105750762 (IL6)    05144 Malaria     105750762 (IL6)    05142 Chagas disease     105750762 (IL6)    05143 African trypanosomiasis     105750762 (IL6)   09163 Immune disease    05323 Rheumatoid arthritis     105750762 (IL6)    05321 Inflammatory bowel disease     105750762 (IL6)    05332 Graft-versus-host disease     105750762 (IL6)   09164 Neurodegenerative disease    05010 Alzheimer disease     105750762 (IL6)    05020 Prion disease     105750762 (IL6)    05022 Pathways of neurodegeneration - multiple diseases     105750762 (IL6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105750762 (IL6)    05410 Hypertrophic cardiomyopathy     105750762 (IL6)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     105750762 (IL6)    04932 Non-alcoholic fatty liver disease     105750762 (IL6)    04931 Insulin resistance     105750762 (IL6)    04933 AGE-RAGE signaling pathway in diabetic complications     105750762 (IL6)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     105750762 (IL6)    01523 Antifolate resistance     105750762 (IL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shr04052]     105750762 (IL6) Cytokines and neuropeptides [BR:shr04052]  Cytokines   Interleukins    105750762 (IL6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL6 GCSF Glyco_hydro_85 DUF5775 DUF2887 Motif Other DBs NCBI-GeneID:  105750762 NCBI-ProteinID:  XP_031796496 UniProt:  G3WCK1 LinkDB All DBs Position 5:complement(275542528..275548261) Genome browser AA seq 215 aa AA seqDB search MGPQLQITGSLGPLAFTLVLLVTTAARPTPDALGVSSKPALGTTDLGKCKSLAKTLYKEA DALKEENGENQSMCDNSSTILAENNLVFPNLTEQDGCFYSGFNKETCLINLISKLQEFDG YFQFMENELKEKKSRIEALKMFTTQLAESLKKLMMGADLVPTLNPTASHDLVLKLKSLNE WSRKVALHLSLCRYIKFMEHTIRAIRNMDPTDVSV NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgggccctcagctccagatcacagggtccctcgggccgctggccttcaccctggtgctg ctcgtcaccacggccgcccgccccaccccggacgccttgggggtctccagcaagccagca ttgggcactaccgacctgggcaaatgcaagagcctagccaaaacgctgtacaaagaagct gacgccctgaaggaagagaatggtgaaaaccagagcatgtgcgacaatagcagcaccata ctagctgaaaacaacctggtctttcccaacttgacagagcaagatggatgcttctattct ggattcaataaggagacatgcctgataaacctcatcagtaaactgcaggaatttgacggg tatttccagttcatggaaaatgagctgaaagaaaagaaaagcaggatcgaagcactaaaa atgttcacgactcaactagccgagtctctgaaaaaattgatgatgggggcagatctagta ccaaccctcaacccaactgcctcccatgacctggttttgaaactgaagagcctgaatgag tggtccaggaaggtggctctccatctcagcctgtgtcgctacatcaagttcatggagcat accattcgggctattcggaacatggaccccacggatgtcagtgtttga

DBGET integrated database retrieval system