Sesamum indicum (sesame): 105161851 Help Entry 105161851         CDS       T04135                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism sind  Sesamum indicum (sesame) Pathway sind00510   N-Glycan biosynthesis sind00513   Various types of N-glycan biosynthesis sind04141   Protein processing in endoplasmic reticulum Module sind_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:sind00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     105161851    00513 Various types of N-glycan biosynthesis     105161851  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     105161851 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 LapA_dom Motif Other DBs NCBI-GeneID:  105161851 NCBI-ProteinID:  XP_011077980 UniProt:  A0A6I9T314 LinkDB All DBs Position LG5:complement(3312326..3315536) Genome browser AA seq 78 aa AA seqDB search MAQSVKPISSPVPDSWYPTLAVFMLAIGLIVTASFFIYEATSSRKNRSLAKELTTGAVAS VFLGFGSLFLLLSSGVYV NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctcagtcagtgaaaccgatctcaagcccagttccagattcgtggtacccgaccctc gccgtgttcatgctcgccatcggcctcattgtcaccgcttcattcttcatctatgaagct acttcctccaggaaaaaccgcagtcttgcaaaggaactgactaccggtgctgttgcatct gtattcttgggttttggatctttattcttgctactctcctctggcgtctatgtttga

DBGET integrated database retrieval system