Sesamum indicum (sesame): 105161929 Help Entry 105161929         CDS       T04135                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism sind  Sesamum indicum (sesame) Pathway sind03420   Nucleotide excision repair sind04120   Ubiquitin mediated proteolysis sind04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:sind00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     105161929    04120 Ubiquitin mediated proteolysis     105161929   09124 Replication and repair    03420 Nucleotide excision repair     105161929  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:sind04121]     105161929    03400 DNA repair and recombination proteins [BR:sind03400]     105161929 Enzymes [BR:sind01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      105161929 Ubiquitin system [BR:sind04121]  Ubiquitin ligases (E3)   UBL E3 ligases    105161929   Multi subunit type E3    SCF complex     Ring finger protein      105161929    Cul2 complex      105161929    Cul3 complex      105161929    Cul4 complex      105161929    Cul7 complex      105161929    Cul8 complex      105161929    Cul9 complex      105161929 DNA repair and recombination proteins [BR:sind03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       105161929     TCR (transcription coupled repair) factors      Cul4-CSA complex       105161929 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  105161929 NCBI-ProteinID:  XP_011078093 UniProt:  A0A6I9T7E5 LinkDB All DBs Position LG5:3871764..3875349 Genome browser AA seq 121 aa AA seqDB search MASLDTDVNMVPAGEGSSGAGPSNPTTSAKKAKRFEIKKWNAVALWAWDIVVDNCAICRN HIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYG H NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atggcgtcgctcgacaccgacgtgaatatggttcccgccggggagggctcttccggggcc ggaccttccaatccgacgacgtccgccaagaaagcgaagcgatttgagatcaagaagtgg aacgccgtcgctctctgggcttgggatattgtggtggacaattgtgctatttgcaggaat catattatggatctctgtattgagtgtcaggctaatcaagccagtgccacgagcgaagaa tgcacggttgcgtggggtgtttgcaaccatgccttccacttccactgcattagcagatgg ctcaagacccgtcaagtctgccctctggataacagcgagtgggagtttcagaagtatggt cactag

DBGET integrated database retrieval system