Sesamum indicum (sesame): 105173683 Help Entry 105173683         CDS       T04135                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism sind  Sesamum indicum (sesame) Pathway sind03420   Nucleotide excision repair sind04120   Ubiquitin mediated proteolysis sind04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:sind00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     105173683    04120 Ubiquitin mediated proteolysis     105173683   09124 Replication and repair    03420 Nucleotide excision repair     105173683  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:sind04121]     105173683    03400 DNA repair and recombination proteins [BR:sind03400]     105173683 Enzymes [BR:sind01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      105173683 Ubiquitin system [BR:sind04121]  Ubiquitin ligases (E3)   UBL E3 ligases    105173683   Multi subunit type E3    SCF complex     Ring finger protein      105173683    Cul2 complex      105173683    Cul3 complex      105173683    Cul4 complex      105173683    Cul7 complex      105173683    Cul8 complex      105173683    Cul9 complex      105173683 DNA repair and recombination proteins [BR:sind03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       105173683     TCR (transcription coupled repair) factors      Cul4-CSA complex       105173683 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  105173683 NCBI-ProteinID:  XP_011093833 UniProt:  A0A6I9UHV6 LinkDB All DBs Position LG11:9233177..9236038 Genome browser AA seq 125 aa AA seqDB search MASLDTDVNMVPAGEVSSDAGPSNPAPPATQSAKKAKRFEIKKWNAVALWAWDIVVDNCA ICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEF QKYGH NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atggcatcgctcgacaccgatgtgaatatggttcccgccggagaggtctcctccgatgct ggaccttctaatccggccccgccggcgacgcaatcagctaagaaagcgaagcgattcgag atcaagaagtggaatgccgtcgcgctctgggcttgggatattgtggtcgataattgtgct atttgccggaaccatatcatggatctctgcattgagtgccaggctaatcaagctagtgca acaagcgaggagtgcacggttgcctggggagtttgcaaccatgccttccacttccattgc attagtaggtggctcaagactcgtcaagtttgccctctggataacagcgaatgggagttt cagaagtatggtcactag

DBGET integrated database retrieval system