Setaria italica (foxtail millet): 101778950 Help Entry 101778950         CDS       T02818                                  Name (RefSeq) RING-box protein 1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism sita  Setaria italica (foxtail millet) Pathway sita03420   Nucleotide excision repair sita04120   Ubiquitin mediated proteolysis sita04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:sita00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     101778950    04120 Ubiquitin mediated proteolysis     101778950   09124 Replication and repair    03420 Nucleotide excision repair     101778950  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:sita04121]     101778950    03400 DNA repair and recombination proteins [BR:sita03400]     101778950 Enzymes [BR:sita01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      101778950 Ubiquitin system [BR:sita04121]  Ubiquitin ligases (E3)   UBL E3 ligases    101778950   Multi subunit type E3    SCF complex     Ring finger protein      101778950    Cul2 complex      101778950    Cul3 complex      101778950    Cul4 complex      101778950    Cul7 complex      101778950    Cul8 complex      101778950    Cul9 complex      101778950 DNA repair and recombination proteins [BR:sita03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       101778950     TCR (transcription coupled repair) factors      Cul4-CSA complex       101778950 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  101778950 NCBI-ProteinID:  XP_004967948 UniProt:  A0A368R2G4 LinkDB All DBs Position V:6144032..6146565 Genome browser AA seq 124 aa AA seqDB search MSAMETDINAPPPPAPAGEGSSAAGPSSSSSRKPNKRFEIKKWNAVALWAWDIVVDNCAI CRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQ KYGH NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atgtccgccatggagaccgacatcaacgcgccgccgccgcccgcccccgccggcgagggc tcctccgcggccggcccgtcctcctcgtcctcccgcaagcccaacaagcgcttcgagatc aagaagtggaacgccgttgcgctgtgggcatgggatatcgtcgtcgacaactgcgccatc tgccgcaaccacatcatggatctatgcatcgagtgccaggcgaaccaggccagcgccacg agcgaggagtgcaccgtcgcttggggtgtctgtaatcatgcttttcacttccactgcatc agcaggtggcttaagactcgccaagtgtgcccattagataacagtgagtgggagttccag aaatatggccactaa

DBGET integrated database retrieval system