Scomber japonicus (chub mackerel): 128354212 Help Entry 128354212         CDS       T09718                                  Name (RefSeq) claudin-10-like   KO K06087   claudin Organism sjo  Scomber japonicus (chub mackerel) Pathway sjo03272   Virion - Hepatitis viruses sjo04382   Cornified envelope formation sjo04514   Cell adhesion molecules sjo04530   Tight junction Brite KEGG Orthology (KO) [BR:sjo00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     128354212  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     128354212  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     128354212  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     128354212  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:sjo03037]     128354212    04147 Exosome [BR:sjo04147]     128354212    04515 Cell adhesion molecules [BR:sjo04515]     128354212 Cilium and associated proteins [BR:sjo03037]  Other cilia and associated proteins   Stereociliary proteins    128354212 Exosome [BR:sjo04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    128354212   Exosomal proteins of colorectal cancer cells    128354212 Cell adhesion molecules [BR:sjo04515]  Immunoglobulin superfamily   L1 family    128354212 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Motif Other DBs NCBI-GeneID:  128354212 NCBI-ProteinID:  XP_053170452 LinkDB All DBs Position 24:complement(14778722..14780244) Genome browser AA seq 145 aa AA seqDB search MWRRLAQILGLLLCVLGWGLVGCTLAMDHWRVAQLGGQGGSSVVVTAWFWSDLWRDCYED STSVVNCVDLGMLWAVKSYIQAVRGLLMSGLVLGLIGIVLTFFGLECTYIGGDRKSKDRM LVTASAFHLVSCEWDLFAFTKPQRM NT seq 438 nt NT seq  +upstreamnt  +downstreamnt atgtggaggagactggctcagattctgggcctgctgctctgtgtactgggctggggcttg gtgggctgcacccttgctatggaccactggagggtggcccagctggggggccaagggggc tcctctgtggtggtgacagcctggttctggtcagacctgtggagggactgctatgaagac tcaacctctgtagtgaactgtgtggacctcgggatgctgtgggcagtcaaatcatacatc caggcagtcagggggctcctgatgtccggccttgtgctcggcctgatcggcatagtgctc acgttctttggactggagtgcacgtacatcggaggagaccggaaaagcaaggacaggatg ttagtaacagcgtctgctttccatctggtcagctgtgagtgggatttgtttgcatttaca aagcctcagcgtatgtga

DBGET integrated database retrieval system