Scomber japonicus (chub mackerel): 128355188 Help Entry 128355188         CDS       T09718                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism sjo  Scomber japonicus (chub mackerel) Pathway sjo04137   Mitophagy - animal sjo04140   Autophagy - animal sjo04144   Endocytosis sjo04145   Phagosome sjo04148   Efferocytosis sjo05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sjo00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     128355188    04145 Phagosome     128355188    04140 Autophagy - animal     128355188    04137 Mitophagy - animal     128355188    04148 Efferocytosis     128355188  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     128355188  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sjo04131]     128355188   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sjo04147]     128355188    04031 GTP-binding proteins [BR:sjo04031]     128355188 Membrane trafficking [BR:sjo04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     128355188 Exosome [BR:sjo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    128355188   Exosomal proteins of other body fluids (saliva and urine)    128355188   Exosomal proteins of colorectal cancer cells    128355188   Exosomal proteins of bladder cancer cells    128355188 GTP-binding proteins [BR:sjo04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     128355188 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 AAA_7 NTPase_1 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT NB-ARC AAA_14 SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  128355188 NCBI-ProteinID:  XP_053171403 LinkDB All DBs Position 3:10962253..10969467 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNERAKPSAETCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatcaaggaagaaagtactacttaaagtcatcatcctcggagactctggagttggg aagacttcattgatgaaccagtatgtgaataagaagttcagtaaccagtacaaagccaca ataggtgctgatttcttgacgaaagaagtcatggtggatgatagacttgtcacaatgcag atttgggacacagcaggtcaggagaggttccagtctttaggcgttgcgttctaccgggga gcagactgctgtgtgctggtgtttgacgtgacggcacccaacaccttcaagactctagac agctggagggacgagttcttgatccaggccagccctcgagatccggagaatttccccttt gtggttctgggcaacaagatcgacctggagaacagacaggtaacaaccaagcgagcacag gcttggtgccagagcaagaacaacatcccatattttgaaaccagcgccaaggaggcgatc aatgtggagcaggccttccagactattgcacgcaatgctcttaaacaggagaccgaagtg gagttgtacaacgagttccccgagccgataaagctagacaggaacgagcgagccaagccg tcagcggagacctgcagctgctga

DBGET integrated database retrieval system