Scomber japonicus (chub mackerel): 128358461 Help Entry 128358461         CDS       T09718                                  Symbol cd59 Name (RefSeq) CD59 glycoprotein   KO K04008   CD59 antigen Organism sjo  Scomber japonicus (chub mackerel) Brite KEGG Orthology (KO) [BR:sjo00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sjo04147]     128358461 (cd59)    04090 CD molecules [BR:sjo04090]     128358461 (cd59)    00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sjo00537]     128358461 (cd59) Exosome [BR:sjo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    128358461 (cd59)   Exosomal proteins of other body fluids (saliva and urine)    128358461 (cd59)   Exosomal proteins of colorectal cancer cells    128358461 (cd59) CD molecules [BR:sjo04090]  Proteins   128358461 (cd59) Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sjo00537]  Antigens   128358461 (cd59) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CD59 UPAR_LY6 Motif Other DBs NCBI-GeneID:  128358461 NCBI-ProteinID:  XP_053174725 LinkDB All DBs Position 5:463740..466983 Genome browser AA seq 116 aa AA seqDB search MKLCAGLFLLLCLFHLGAGLRCYKCSDYTGRCENVQECTYEDSCISLSERGGKTIRQCIR YTDCDNSRLTQMFPAISGFTYRCCSSNLCNSSNAVTMATPVLALIGWLLSVCCITN NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgaagctctgtgctggactcttcctgctgctctgcctcttccacctgggtgcaggtctt cggtgttataagtgctcagactacaccgggcgctgtgagaatgtgcaggagtgcacctac gaggactcgtgtatctctctgagtgagagaggagggaagaccatccgtcagtgtatccgg tacacagactgtgataactcccgcctcactcagatgtttcccgccatctccggcttcacg taccgctgctgcagcagcaacctgtgcaactccagcaacgccgtcaccatggcgacgccc gtcctggctctgattggctggctgctgagcgtgtgctgcatcactaactga

DBGET integrated database retrieval system