Scomber japonicus (chub mackerel): 128365876 Help Entry 128365876         CDS       T09718                                  Symbol cdc42l Name (RefSeq) cell division cycle 42, like   KO K04393   cell division control protein 42 Organism sjo  Scomber japonicus (chub mackerel) Pathway sjo04010   MAPK signaling pathway sjo04144   Endocytosis sjo04370   VEGF signaling pathway sjo04510   Focal adhesion sjo04520   Adherens junction sjo04530   Tight junction sjo04810   Regulation of actin cytoskeleton sjo04912   GnRH signaling pathway sjo05100   Bacterial invasion of epithelial cells sjo05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sjo00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     128365876 (cdc42l)    04370 VEGF signaling pathway     128365876 (cdc42l)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     128365876 (cdc42l)   09144 Cellular community - eukaryotes    04510 Focal adhesion     128365876 (cdc42l)    04520 Adherens junction     128365876 (cdc42l)    04530 Tight junction     128365876 (cdc42l)   09142 Cell motility    04810 Regulation of actin cytoskeleton     128365876 (cdc42l)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     128365876 (cdc42l)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     128365876 (cdc42l)    05100 Bacterial invasion of epithelial cells     128365876 (cdc42l)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sjo04131]     128365876 (cdc42l)    03036 Chromosome and associated proteins [BR:sjo03036]     128365876 (cdc42l)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sjo04147]     128365876 (cdc42l)    04031 GTP-binding proteins [BR:sjo04031]     128365876 (cdc42l) Membrane trafficking [BR:sjo04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     128365876 (cdc42l)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     128365876 (cdc42l)   Macropinocytosis    Ras GTPases     128365876 (cdc42l) Chromosome and associated proteins [BR:sjo03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     128365876 (cdc42l) Exosome [BR:sjo04147]  Exosomal proteins   Exosomal proteins of microglial cells    128365876 (cdc42l)   Exosomal proteins of breast milk    128365876 (cdc42l) GTP-binding proteins [BR:sjo04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     128365876 (cdc42l) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  128365876 NCBI-ProteinID:  XP_053182468 LinkDB All DBs Position 10:8478738..8485208 Genome browser AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEISHHCPRTPFLLVGTQMDLR EDSNTIEKLAKNKQRPLYPESGEKLARELKAVKYVECSALTQRGLKNVFDEAILAALEPP ETKTKRKCVLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagactataaaatgtgtagtggtaggagacggggctgtaggaaagacctgcttactg atctcctacacaaccaacaagttcccctcagaatatgtgcctacggtttttgacaattat gcagtgacagtgatgattgggggggagccctatacactcggcctttttgacactgcaggt caggaggattatgacaggctgcgtcctctcagttatccacagactgatgtgttccttgta tgtttctctgtcgtctccccctcatcatttgaaaatgtcaaagagaagtgggttcctgag atttctcaccactgcccacgcacaccttttctgttagtgggcacacagatggacttgcgg gaagacagcaacacgattgagaagctggcaaagaacaaacagcgccccctttatcctgag agtggagaaaagttggcccgtgagctcaaggctgtcaaatatgtggagtgctctgctctc acacagcgagggcttaagaatgtgtttgacgaggccatcctggcagccttggagccccct gagaccaaaaccaagagaaagtgcgttctgctatag

DBGET integrated database retrieval system