Scomber japonicus (chub mackerel): 128366314 Help Entry 128366314         CDS       T09718                                  Name (RefSeq) metallothionein A-like   KO K14739   metallothionein 1/2 Organism sjo  Scomber japonicus (chub mackerel) Brite KEGG Orthology (KO) [BR:sjo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:sjo03019]     128366314    03029 Mitochondrial biogenesis [BR:sjo03029]     128366314 Messenger RNA biogenesis [BR:sjo03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      128366314 Mitochondrial biogenesis [BR:sjo03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     128366314 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  128366314 NCBI-ProteinID:  XP_053182971 LinkDB All DBs Position 10:33440257..33441024 Genome browser AA seq 60 aa AA seqDB search MDPCECTKTGTCSCAESCTCTNCSCTSCKKSCCSCCPSDCSKCASGCVCKGKTCDTSCCQ NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atggacccttgtgaatgcaccaagactggaacctgcagctgtgctgaatcctgcacctgc acaaactgctcctgcacctcctgcaagaagagctgctgctcatgctgtccatctgactgc agcaagtgtgcctctggctgtgtgtgcaaagggaagacctgtgataccagctgctgtcag tga

DBGET integrated database retrieval system