Scomber japonicus (chub mackerel): 128371064 Help Entry 128371064         CDS       T09718                                  Name (RefSeq) insulin   KO K04526   insulin Organism sjo  Scomber japonicus (chub mackerel) Pathway sjo04010   MAPK signaling pathway sjo04068   FoxO signaling pathway sjo04081   Hormone signaling sjo04114   Oocyte meiosis sjo04140   Autophagy - animal sjo04150   mTOR signaling pathway sjo04810   Regulation of actin cytoskeleton sjo04910   Insulin signaling pathway sjo04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:sjo00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     128371064    04068 FoxO signaling pathway     128371064    04150 mTOR signaling pathway     128371064   09133 Signaling molecules and interaction    04081 Hormone signaling     128371064  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     128371064   09143 Cell growth and death    04114 Oocyte meiosis     128371064   09142 Cell motility    04810 Regulation of actin cytoskeleton     128371064  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     128371064    04914 Progesterone-mediated oocyte maturation     128371064  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sjo04052]     128371064 Cytokines and neuropeptides [BR:sjo04052]  Neuropeptides   Unclassified    128371064 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  128371064 NCBI-ProteinID:  XP_053187238 LinkDB All DBs Position 13:complement(2764201..2765603) Genome browser AA seq 113 aa AA seqDB search MAALWLQSASLLVLLVLSWPGSQAAAGPQHLCGSHLVDALYLVCGERGFFYNPKRDVDPL QGFLPPKAGGAGGQNEVAEFAYKDQMEMMVKRGIVEQCCHKPCNIFDLQNYCN NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggcggctctgtggctccagtctgcgtctctgctggtcttactggttctatcgtggccc ggttctcaggccgccgccggccctcagcacctgtgtggctctcacctggtcgacgctctc tacctggtctgtggagagagaggcttcttctacaatcccaagagagacgtcgaccctctg cagggtttcctccctcctaaggcgggaggcgctggcggccagaacgaggtggcagagttc gcctataaggaccagatggagatgatggtgaagcgaggcatcgtggagcaatgctgccac aaaccctgcaacatcttcgacctgcagaactactgcaactga

DBGET integrated database retrieval system