Scomber japonicus (chub mackerel): 128371809 Help Entry 128371809         CDS       T09718                                  Symbol myl10 Name (RefSeq) myosin regulatory light chain 10   KO K12756   myosin regulatory light chain 10 Organism sjo  Scomber japonicus (chub mackerel) Pathway sjo04510   Focal adhesion sjo04520   Adherens junction sjo04810   Regulation of actin cytoskeleton sjo04814   Motor proteins sjo05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sjo00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     128371809 (myl10)    04520 Adherens junction     128371809 (myl10)   09142 Cell motility    04814 Motor proteins     128371809 (myl10)    04810 Regulation of actin cytoskeleton     128371809 (myl10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     128371809 (myl10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:sjo04812]     128371809 (myl10) Cytoskeleton proteins [BR:sjo04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      128371809 (myl10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 SAPC2_N EF-hand_5 Motif Other DBs NCBI-GeneID:  128371809 NCBI-ProteinID:  XP_053188160 LinkDB All DBs Position 13:9478676..9484003 Genome browser AA seq 150 aa AA seqDB search MFEQSQIQEFKEAFTIMDQNRDGFIDKGDLRDTYAALGRLNVGNDELEEMTKEAPGPINF TIFLAMFGEKLKGTDPEETILNAFKIFDPEGTGALKGEDIKYHLMSQADKFTEEEVNQMF TNFPLDVAGNLDYKNLCYVITHGEDKEQEE NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atgtttgagcagtcacagatccaggagttcaaggaggctttcaccatcatggaccagaac agagatggtttcattgacaaaggggacctgagagacacatacgctgctctgggccgtctc aatgttggcaatgatgagctggaagagatgacgaaggaggctcccggccccatcaacttc accatcttcctagctatgtttggcgagaagcttaaaggtaccgaccctgaggaaaccatt ctcaacgcattcaagatctttgaccctgaaggaacaggagccctgaaaggagaggacatc aaataccaccttatgtctcaggcagacaagttcaccgaggaagaggtaaaccagatgttc acaaactttcctctggacgtagctggaaacctggattacaagaacctgtgctatgtcatt acccacggagaggataaggaacaggaggagtga

DBGET integrated database retrieval system