Scomber japonicus (chub mackerel): 128374058 Help Entry 128374058         CDS       T09718                                  Symbol s100a10a Name (RefSeq) protein S100-A10a   KO K17274   protein S100-A10 Organism sjo  Scomber japonicus (chub mackerel) Pathway sjo04382   Cornified envelope formation sjo05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sjo00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     128374058 (s100a10a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     128374058 (s100a10a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sjo04147]     128374058 (s100a10a) Exosome [BR:sjo04147]  Exosomal proteins   Exosomal proteins of microglial cells    128374058 (s100a10a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 EH SPARC_Ca_bdg MCM4_WHD DUF7078 Motif Other DBs NCBI-GeneID:  128374058 NCBI-ProteinID:  XP_053190267 LinkDB All DBs Position 15:complement(12963176..12965022) Genome browser AA seq 100 aa AA seqDB search MPSELETSMESLIKVFHRYASKDGKAGTLNRRELRELMENELSNFLKSQKDPAAVDKIMK DLDTNGDGQVDFEEFVSLVVGLSIACEQCYQMHMKKTAKK NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgccttcagaactggagacatccatggagtccctcatcaaggtgttccaccgttacgcc tctaaggacggcaaggccggcacactcaaccgacgagagcttagagagttgatggagaac gagctgtctaactttcttaagtctcagaaggaccctgctgctgtcgacaagatcatgaag gacctggacacaaatggtgatggccaggtggactttgaggagtttgtttctctggttgtt ggactttccattgcctgtgagcagtgctatcagatgcacatgaagaagacggcaaagaag taa

DBGET integrated database retrieval system