Scomber japonicus (chub mackerel): 128377427 Help Entry 128377427         CDS       T09718                                  Name (RefSeq) mitoregulin-like   KO K29035   mitoregulin Organism sjo  Scomber japonicus (chub mackerel) Brite KEGG Orthology (KO) [BR:sjo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:sjo03029]     128377427 Mitochondrial biogenesis [BR:sjo03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Other regulator of mitochondrial biogenesis     128377427 SSDB OrthologParalogGFIT Motif Pfam:  MTLN LapA_dom Motif Other DBs NCBI-GeneID:  128377427 NCBI-ProteinID:  XP_053193353 LinkDB All DBs Position 17:complement(16169853..16171307) Genome browser AA seq 56 aa AA seqDB search MADISERTLQVAVVASFAAGFLAGWQANRMRRKFLDWRKKRLQDKLSETQKKIDLS NT seq 171 nt NT seq  +upstreamnt  +downstreamnt atggcagacatctcggagaggacacttcaagtcgccgtcgtggcttcgttcgcagccggc ttcctggcggggtggcaggccaacagaatgagaagaaagtttctggactggaggaagaaa cggctgcaagataagctgtcggaaacacagaagaagatagacttgtcttaa

DBGET integrated database retrieval system