Scomber japonicus (chub mackerel): 128378255 Help Entry 128378255         CDS       T09718                                  Symbol rras Name (RefSeq) ras-related protein R-Ras   KO K07830   Ras-related protein R-Ras2 Organism sjo  Scomber japonicus (chub mackerel) Pathway sjo04010   MAPK signaling pathway sjo04137   Mitophagy - animal sjo04140   Autophagy - animal sjo04218   Cellular senescence sjo04371   Apelin signaling pathway sjo04625   C-type lectin receptor signaling pathway sjo04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:sjo00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     128378255 (rras)    04371 Apelin signaling pathway     128378255 (rras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     128378255 (rras)    04137 Mitophagy - animal     128378255 (rras)   09143 Cell growth and death    04218 Cellular senescence     128378255 (rras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     128378255 (rras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     128378255 (rras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sjo04147]     128378255 (rras)    04031 GTP-binding proteins [BR:sjo04031]     128378255 (rras) Exosome [BR:sjo04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    128378255 (rras)   Exosomal proteins of bladder cancer cells    128378255 (rras) GTP-binding proteins [BR:sjo04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     128378255 (rras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf MMR_HSR1 ATP_bind_1 MMR_HSR1_Xtn Motif Other DBs NCBI-GeneID:  128378255 NCBI-ProteinID:  XP_053193686 LinkDB All DBs Position 18:complement(584039..594599) Genome browser AA seq 197 aa AA seqDB search MSGEEERFKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGKETRLDIL DTAGQEEFGAMREQYMRSGEGFLLVFALNDRGSYHEVQKFHTQILRVKDRDDYPMVLVGN KADLEQQRVISREDAQAFARENRIHYMEASAKNRYNVDEVFLELVQIIRRFQEMESPPPT AHHTGKQSRGGCPCVLL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcggagaagaggaaagattcaaactggtggtggtgggaggaggaggggtggggaag agcgccctgaccatccagttcattcagtcctactttgtgtcagactacgaccccaccatc gaagactcctacaccaagatctgcacagtggatggaaaggagacccggctggacatcttg gatacagcaggtcaggaggagtttggggcgatgagggagcagtacatgcgctcaggagag ggcttcctactggtgttcgcactcaatgaccggggcagctaccatgaggtgcagaagttc cacacccagatcttgagggtgaaggaccgagacgactaccccatggtgctggttggaaac aaggcagacctggaacagcagagagtgatctccagggaggacgctcaggccttcgccaga gagaacaggatccactacatggaggcttcagccaagaaccgctacaatgtagatgaagtc ttcttggagctagtgcagattatcagacggtttcaggagatggagagtcctcctcctaca gctcatcacacagggaaacagtcacgtggtggctgtccctgtgtcctcctttaa

DBGET integrated database retrieval system