Scomber japonicus (chub mackerel): 128381391 Help Entry 128381391         CDS       T09718                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism sjo  Scomber japonicus (chub mackerel) Pathway sjo04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:sjo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     128381391  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:sjo04121]     128381391    03400 DNA repair and recombination proteins [BR:sjo03400]     128381391 Ubiquitin system [BR:sjo04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      128381391    Cul5 complex      128381391 DNA repair and recombination proteins [BR:sjo03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      128381391 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  128381391 NCBI-ProteinID:  XP_053197378 LinkDB All DBs Position 20:15532429..15535947 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRPPEDQRLYKDDQLLEDSKTLGDS GFTNQTARPQAPATVGLAFRINDEMFEQLHVEAFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcttaatgatccggcgtcacaagaccacaatcttcacagatgccaaggag tccaccaccgtctatgagctaaagcgtattgtcgaaggtatcctgaagagaccacctgaa gaccagcggctttacaaagatgaccagctgctagaggacagcaaaactctcggtgacagc ggattcaccaaccagactgccagacctcaggccccagctacagttggtctggctttccgc atcaatgatgagatgtttgagcagctgcacgtcgaggccttctccagccccccagaactc cctgatgtgatgaagcctcaggactccggtagcaccgccaacgaacaggcagtgcagtga

DBGET integrated database retrieval system