Scomber japonicus (chub mackerel): 128383360 Help Entry 128383360         CDS       T09718                                  Name (RefSeq) histone H2A.Z   KO K11251   histone H2A Organism sjo  Scomber japonicus (chub mackerel) Pathway sjo03082   ATP-dependent chromatin remodeling sjo04217   Necroptosis Brite KEGG Orthology (KO) [BR:sjo00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     128383360  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     128383360  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sjo03036]     128383360   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sjo04147]     128383360 Chromosome and associated proteins [BR:sjo03036]  Eukaryotic type   Nucleosome assembly factors    Histones     128383360 Exosome [BR:sjo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    128383360 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Histone_H2A_C CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  128383360 NCBI-ProteinID:  XP_053198964 LinkDB All DBs Position 22:4578667..4580950 Genome browser AA seq 128 aa AA seqDB search MAGGKAGKDSGKTKTKAISRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILE YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG KKGQQKTV NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggctggtggtaaagcaggtaaagactccgggaagactaagacgaaggctatttcgcgc tcgcagagagcaggactgcagttccccgtgggtcgtatccacagacacctcaagtccagg accaccagccacggcagagtgggagccactgcagcggtgtacagcgcggctatcctcgaa tacctcactgccgaggtcctggagttggcaggaaatgcttctaaggatcttaaagtgaag cgtataactccacgccacttgcagctggccatcagaggagacgaggagctggattcactt atcaaggccactattgctggtggaggtgtgatccctcacatccacaagtcgctgatcgga aagaagggccagcagaagactgtataa

DBGET integrated database retrieval system