Serpula lacrymans: SERLADRAFT_385744 Help Entry SERLADRAFT_385744 CDS       T03135                                  Name (RefSeq) hypothetical protein   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism sla  Serpula lacrymans Pathway sla03420   Nucleotide excision repair sla04111   Cell cycle - yeast sla04120   Ubiquitin mediated proteolysis sla04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:sla00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     SERLADRAFT_385744    04120 Ubiquitin mediated proteolysis     SERLADRAFT_385744   09124 Replication and repair    03420 Nucleotide excision repair     SERLADRAFT_385744  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     SERLADRAFT_385744  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:sla04121]     SERLADRAFT_385744    03400 DNA repair and recombination proteins [BR:sla03400]     SERLADRAFT_385744 Enzymes [BR:sla01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      SERLADRAFT_385744 Ubiquitin system [BR:sla04121]  Ubiquitin ligases (E3)   UBL E3 ligases    SERLADRAFT_385744   Multi subunit type E3    SCF complex     Ring finger protein      SERLADRAFT_385744    Cul2 complex      SERLADRAFT_385744    Cul3 complex      SERLADRAFT_385744    Cul4 complex      SERLADRAFT_385744    Cul7 complex      SERLADRAFT_385744    Cul8 complex      SERLADRAFT_385744    Cul9 complex      SERLADRAFT_385744 DNA repair and recombination proteins [BR:sla03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       SERLADRAFT_385744     TCR (transcription coupled repair) factors      Cul4-CSA complex       SERLADRAFT_385744 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_16 Motif Other DBs NCBI-GeneID:  18811169 NCBI-ProteinID:  XP_007316893 JGI:  385744 UniProt:  F8NR73 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MADMEVDTPAAAPVVKKENKDDTKEGKKRFEVKKWNAVSLWAWDIVVDNCAICRNHIMDL CIDCQANQVSATSEECNAAWGICNHAFHFHCISRWLKTRNVCPLDNREWELQKYGR NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggctgatatggaagtcgacacccctgcagctgctcctgttgtaaagaaagagaacaaa gatgacacgaaggaaggcaagaagagattcgaggtaaagaagtggaatgccgtatcgctc tgggcgtgggatatcgtcgtagacaattgtgctatatgcaggaatcatatcatggaccta tgtatcgactgtcaggcgaatcaggtctcagcgacaagtgaagagtgtaacgctgcttgg ggtatctgcaaccatgcctttcatttccattgcatttcccgttggttgaaaacgagaaat gtatgcccattggacaatcgtgaatgggaactacagaaatacgggcgttaa

DBGET integrated database retrieval system