Silene latifolia (white campion): 141597139 Help Entry 141597139         CDS       T11116                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism slaf  Silene latifolia (white campion) Pathway slaf03420   Nucleotide excision repair slaf04120   Ubiquitin mediated proteolysis slaf04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:slaf00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     141597139    04120 Ubiquitin mediated proteolysis     141597139   09124 Replication and repair    03420 Nucleotide excision repair     141597139  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:slaf04121]     141597139    03400 DNA repair and recombination proteins [BR:slaf03400]     141597139 Enzymes [BR:slaf01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      141597139 Ubiquitin system [BR:slaf04121]  Ubiquitin ligases (E3)   UBL E3 ligases    141597139   Multi subunit type E3    SCF complex     Ring finger protein      141597139    Cul2 complex      141597139    Cul3 complex      141597139    Cul4 complex      141597139    Cul7 complex      141597139    Cul8 complex      141597139    Cul9 complex      141597139 DNA repair and recombination proteins [BR:slaf03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       141597139     TCR (transcription coupled repair) factors      Cul4-CSA complex       141597139 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF4805 DUF8003 Motif Other DBs NCBI-GeneID:  141597139 NCBI-ProteinID:  XP_074273593 LinkDB All DBs Position 8:complement(101216656..101252631) Genome browser AA seq 125 aa AA seqDB search MDTDITMVAADEPSDPTVPSSSAATAVASSSSAKKNKRFEIKKWNAVALWAWDIVVDNCA ICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEF QKYGH NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atggataccgacatcaccatggtcgccgctgacgaaccttccgatcccaccgttccgtct tcttccgccgcaaccgccgtcgcgtcttcttcttctgctaagaaaaacaagcgtttcgag atcaaaaagtggaacgccgttgctctttgggcttgggatattgtcgtcgataactgtgct atttgcaggaaccacatcatggatctctgtattgagtgtcaagctaatcaagctagtgct acgagcgaggagtgtactgttgcttggggagtctgcaatcacgcgtttcattttcactgc atcagcagatggctcaaaacccgccaagtgtgcccactagacaacagtgaatgggagttt cagaagtatggtcactag

DBGET integrated database retrieval system