Silene latifolia (white campion): 141605788 Help Entry 141605788         CDS       T11116                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism slaf  Silene latifolia (white campion) Pathway slaf03420   Nucleotide excision repair slaf04120   Ubiquitin mediated proteolysis slaf04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:slaf00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     141605788    04120 Ubiquitin mediated proteolysis     141605788   09124 Replication and repair    03420 Nucleotide excision repair     141605788  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:slaf04121]     141605788    03400 DNA repair and recombination proteins [BR:slaf03400]     141605788 Enzymes [BR:slaf01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      141605788 Ubiquitin system [BR:slaf04121]  Ubiquitin ligases (E3)   UBL E3 ligases    141605788   Multi subunit type E3    SCF complex     Ring finger protein      141605788    Cul2 complex      141605788    Cul3 complex      141605788    Cul4 complex      141605788    Cul7 complex      141605788    Cul8 complex      141605788    Cul9 complex      141605788 DNA repair and recombination proteins [BR:slaf03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       141605788     TCR (transcription coupled repair) factors      Cul4-CSA complex       141605788 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 Motif Other DBs NCBI-GeneID:  141605788 NCBI-ProteinID:  XP_074280785 LinkDB All DBs Position 10:105273113..105277849 Genome browser AA seq 117 aa AA seqDB search MASMDVDVAMVPADEGSNPTGPSSSKKNKRFEIKKWNAVSLWAWDIVVDNCAICRNHIMD LCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggcatccatggatgttgacgtagcaatggttcccgccgacgaaggttcaaaccctact gggccatcttcctccaaaaaaaacaagcgctttgagatcaagaagtggaacgctgtttct ctctgggcttgggatattgtggtcgataattgtgctatttgtaggaaccacatcatggat ctttgcatcgagtgtcaagctaatcaggctagtgctactagcgaggagtgtactgttgct tggggagtctgcaatcatgcatttcactttcactgcatcagccgatggctcaagacccgt caagtgtgcccactagataacagtgaatgggagtttcagaagtatggccactag

DBGET integrated database retrieval system