KEGG   Streptomyces leeuwenhoekii: sle_13150
Entry
sle_13150         CDS       T04414                                 
Symbol
sle_13150
Name
(GenBank) Putative cytochrome P450 139
  KO
K15907  pentalenene oxygenase [EC:1.14.15.32]
Organism
sle  Streptomyces leeuwenhoekii
Pathway
sle00909  Sesquiterpenoid and triterpenoid biosynthesis
sle00998  Biosynthesis of various antibiotics
sle01100  Metabolic pathways
sle01110  Biosynthesis of secondary metabolites
Module
sle_M00819  Pentalenolactone biosynthesis, farnesyl-PP => pentalenolactone
Brite
KEGG Orthology (KO) [BR:sle00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    sle_13150 (sle_13150)
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various antibiotics
    sle_13150 (sle_13150)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:sle00199]
    sle_13150 (sle_13150)
Enzymes [BR:sle01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.32  pentalenene oxygenase
     sle_13150 (sle_13150)
Cytochrome P450 [BR:sle00199]
 Cytochrome P450, bacteria type
  CYP183 family
   sle_13150 (sle_13150)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: CQR60777
UniProt: A0A0F7VTB6
LinkDB
Position
chromosome:complement(1632633..1634027)
AA seq 464 aa
MSEQTTFVAGAAPGAVPVVGHALQMMRHPVNFMTSLSAHGDLVQIKIGPTSAYVPTHPDL
LRYVLTNDRIFDKGGVFYDRARDIAGNGLVTCPFADHRRQRRLMQSAFTRTQLKRYATAM
HAEIEATTARWHDGMVVDAFPELYGMALRTVGRTLYSTPVSPELAAGVERAFDVVLNGLF
RQMFLPRFIRRLPLPANRRYESNLRFLHRTTQELIDDYRSDGAAHDDLLAALLASRDDDG
GRLDDKEIHDQVITVMAAGTETVAGTLTWVFYLLSQHPEIEAALYEEIDTVLGGRAPDWD
DLPNLSLADRIISEALRLHPPAWLFTRLTATETELAGRRLPEGTTIVFSPAAVAQYEDAF
GNPTAFDPDRWLPDRVSPAARQAFMPFGTGARKCIGDLYARTEATLGLATILGRWRVTCE
PDMDVRPVPLATVYHPRRLRLRLSARTPRPAATPVPAPAGGDPA
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgtccgagcagaccacgttcgtcgcgggcgcggcgcccggggccgtccccgtcgtggga
cacgccctgcagatgatgcgccacccggtgaacttcatgacctcgctgtcggcccacggc
gacctggtgcagatcaagatcggccccacgtcggcctacgtcccgacccaccccgacctg
ctgcggtacgtgctgaccaacgaccgcatcttcgacaagggcggcgtcttctacgaccgg
gcccgcgacatcgccgggaacggtctggtcacctgccccttcgccgaccaccgccggcag
cggcggctgatgcagtcggcgttcacccgcacccagctcaagcggtacgcgaccgccatg
cacgccgagatcgaggccacgacggcgcgctggcacgacggcatggtcgtcgacgcgttc
cccgagctgtacggcatggccctgcgcacggtcggccgcaccctgtactccaccccggtc
agccccgagctcgcggccggcgtggagcgggccttcgacgtcgtgctcaacgggctgttc
cgccagatgttcctgccccgcttcatccgccgcctgccgctgccggccaaccgccgctac
gagagcaacctgcgcttcctgcaccgcaccacgcaggaactgatcgacgactaccgcagc
gacggcgccgcgcacgacgacctgctcgccgcgctgctggcctcccgcgacgacgacggc
ggccggctcgacgacaaggagatccacgaccaggtcatcaccgtgatggccgccggcacc
gagaccgtcgccggcaccctcacctgggtgttctacctgctctcccagcacccggagatc
gaggcggcgctgtacgaggagatcgacaccgtcctcggcggccgcgccccggactgggac
gacctgccgaacctctccctggccgaccggatcatctccgaggcgctccggctgcacccg
ccggcctggctgttcacccggctcaccgccaccgagaccgaactggcgggccgcaggctg
cccgagggaaccaccatcgtcttcagcccggccgcggtggcccagtacgaggacgccttc
ggcaaccccacggcgttcgacccggaccgctggctgccggaccgggtctcgcccgcggcc
cgccaggcgttcatgccgttcggcaccggcgcccgcaagtgcatcggcgacctgtacgcg
cgtaccgaggccacgctgggcctggccaccatcctcggccgctggcgggtcacctgcgag
ccggacatggacgtccgtcccgtaccgctggccaccgtctaccatccgcgccggctgcgc
ctgaggctctccgcgcgcaccccgcgccccgcggccaccccggtgccggcgccggccggg
ggtgaccccgcatga

DBGET integrated database retrieval system