Streptomyces leeuwenhoekii: sle_59930 Help Entry sle_59930         CDS       T04414                                  Symbol sle_59930 Name (GenBank) Triosephosphate isomerase   KO K01803   triosephosphate isomerase (TIM) [EC:5.3.1.1] Organism sle  Streptomyces leeuwenhoekii Pathway sle00010   Glycolysis / Gluconeogenesis sle00051   Fructose and mannose metabolism sle00562   Inositol phosphate metabolism sle00710   Carbon fixation by Calvin cycle sle01100   Metabolic pathways sle01110   Biosynthesis of secondary metabolites sle01120   Microbial metabolism in diverse environments sle01200   Carbon metabolism sle01230   Biosynthesis of amino acids Module sle_M00001   Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate sle_M00002   Glycolysis, core module involving three-carbon compounds sle_M00003   Gluconeogenesis, oxaloacetate => fructose-6P Brite KEGG Orthology (KO) [BR:sle00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     sle_59930 (sle_59930)    00051 Fructose and mannose metabolism     sle_59930 (sle_59930)    00562 Inositol phosphate metabolism     sle_59930 (sle_59930)   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     sle_59930 (sle_59930)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sle04147]     sle_59930 (sle_59930) Enzymes [BR:sle01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.1  triose-phosphate isomerase      sle_59930 (sle_59930) Exosome [BR:sle04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    sle_59930 (sle_59930)   Exosomal proteins of bladder cancer cells    sle_59930 (sle_59930)   Exosomal proteins of melanoma cells    sle_59930 (sle_59930) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TIM Motif Other DBs NCBI-ProteinID:  CQR65449 UniProt:  A0A0F7VY66 LinkDB All DBs Position chromosome:6999440..6999931 Genome browser AA seq 163 aa AA seqDB search MTNPGSGMKALAPPLTCTSTKMNLGLSDTLRWLDDIVLPHAPELARLAFFACLPHPLLTV ARARLGDCGVGVGAQNCWFEGGAVTGEVSADLLAELGCRHVMLGHAERRRLFGEDDDLIA RKVAAALDAGLVPLLCVGEDTRLGPEDAARHVVRQAAVLALVR NT seq 492 nt NT seq  +upstreamnt  +downstreamnt atgaccaaccccgggagcggtatgaaggccctcgccccaccgttgacctgcaccagcacc aagatgaacctcggcctctccgacaccctgcgctggctggacgacatcgtcctgccccac gcgcccgagctggcccgcctggccttcttcgcctgcctgccacaccccctgctgaccgtc gcccgggcccgcctcggtgactgcggcgtcggcgtcggggcgcagaactgctggttcgag ggcggcgcggtcacgggcgaggtgagcgcggacctgctcgccgagctcggctgccgccac gtcatgctgggccacgccgagcgccgccgcctcttcggcgaggacgacgacctgatcgcg cgcaaggtcgccgccgctctcgacgccggactcgtccccctgctctgcgtcggcgaggac acccggctcggccccgaggacgccgcccgccacgtggtgcggcaggccgcggttctcgcc ctggttcggtaa

DBGET integrated database retrieval system