Spodoptera litura (tobacco cutworm): 111356263 Help Entry 111356263         CDS       T08157                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism sliu  Spodoptera litura (tobacco cutworm) Pathway sliu00510   N-Glycan biosynthesis sliu00513   Various types of N-glycan biosynthesis sliu04141   Protein processing in endoplasmic reticulum Module sliu_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:sliu00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     111356263    00513 Various types of N-glycan biosynthesis     111356263  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     111356263 SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 Motif Other DBs NCBI-GeneID:  111356263 NCBI-ProteinID:  XP_022826329 UniProt:  A0A9J7EF23 LinkDB All DBs Position 22:1894311..1894835 Genome browser AA seq 81 aa AA seqDB search MSLEIESMVRYTSPINPAVFPHLTLLLLGIGIFFTAWFFVYEVTSTKVSRDLFKELLLSL VASLFSGFGILFLLLWVGIYV NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgagtctggaaattgaatccatggtgcgctacacgtctcctatcaacccggcagttttc ccgcatcttactcttctcctcctcggtatcggcattttcttcactgcctggttctttgta tacgaagttactagcactaaagtgtcgagggatctgttcaaagaattgttattgtcgctg gtcgcctccctattttccggcttcgggattcttttcttactactatgggtgggaatttac gtgtaa

DBGET integrated database retrieval system