Sander lucioperca (pikeperch): 116038462 Help Entry 116038462         CDS       T07345                                  Symbol tmem258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism sluc  Sander lucioperca (pikeperch) Pathway sluc00510   N-Glycan biosynthesis sluc00513   Various types of N-glycan biosynthesis sluc04141   Protein processing in endoplasmic reticulum Module sluc_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:sluc00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     116038462 (tmem258)    00513 Various types of N-glycan biosynthesis     116038462 (tmem258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     116038462 (tmem258) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 TctB Motif Other DBs NCBI-GeneID:  116038462 NCBI-ProteinID:  XP_031138760 Ensembl:  ENSSLUG00000001211 UniProt:  A0A8C9WZM3 LinkDB All DBs Position 7:10666812..10668444 Genome browser AA seq 79 aa AA seqDB search MELEAMTRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDVYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaactcgaggctatgaccagatacaccagcccggtgaacccggctgtgttcccccac ctcactgtcgtcctgctggccatcggcatgttcttcactgcctggttcttcgtctacgag gtgacatcaacaaaatacaccagggacgtctacaaagagctgctgatctccctcgtggct tcacttttcatgggcttcggtgtgctcttcttattactctgggttggcatctatgtatga

DBGET integrated database retrieval system