Sander lucioperca (pikeperch): 116055235 Help Entry 116055235         CDS       T07345                                  Symbol pole4 Name (RefSeq) DNA polymerase epsilon subunit 4   KO K03506   DNA polymerase epsilon subunit 4 [EC:2.7.7.7] Organism sluc  Sander lucioperca (pikeperch) Pathway sluc03030   DNA replication sluc03410   Base excision repair sluc03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:sluc00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     116055235 (pole4)    03410 Base excision repair     116055235 (pole4)    03420 Nucleotide excision repair     116055235 (pole4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sluc03032]     116055235 (pole4)    03400 DNA repair and recombination proteins [BR:sluc03400]     116055235 (pole4) Enzymes [BR:sluc01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      116055235 (pole4) DNA replication proteins [BR:sluc03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     116055235 (pole4) DNA repair and recombination proteins [BR:sluc03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       116055235 (pole4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C TAF Motif Other DBs NCBI-GeneID:  116055235 NCBI-ProteinID:  XP_031162927 Ensembl:  ENSSLUG00000005935 UniProt:  A0A8C9XL69 LinkDB All DBs Position 11:7906029..7908857 Genome browser AA seq 129 aa AA seqDB search MAATAATPVTPTEPDPDRCVSEEESRGAEAEEENTQQQTGPAAAVSHSRLSKLPLARIKA LMKTDPDVSLASQESVFIIAKATELFVEMIAKDSLVYAQQGKRKTLQRKDLDNAIEAIDE FAFLEGTLD NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atggcagcaacagcagctacacctgtcaccccaacggagcccgaccctgaccggtgtgtg agtgaggaggagagccgcggggccgaggcggaggaggagaacacccagcagcagacaggc cccgcggccgccgtgagccacagccgactgtccaaactcccgctggcccgcatcaaggcg ctcatgaagaccgatccagacgtgtcgctcgccagccaggagtctgtgtttatcatcgct aaagccacggagttgtttgttgagatgattgccaaagattccctagtgtacgcccagcag gggaagaggaaaactttgcaaagaaaagatttggacaacgcaatagaggccatagatgaa tttgcatttcttgaaggcacactagattaa

DBGET integrated database retrieval system