Sander lucioperca (pikeperch): 116065292 Help Entry 116065292         CDS       T07345                                  Symbol rbx1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism sluc  Sander lucioperca (pikeperch) Pathway sluc03420   Nucleotide excision repair sluc04110   Cell cycle sluc04114   Oocyte meiosis sluc04120   Ubiquitin mediated proteolysis sluc04141   Protein processing in endoplasmic reticulum sluc04310   Wnt signaling pathway sluc04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:sluc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     116065292 (rbx1)    04120 Ubiquitin mediated proteolysis     116065292 (rbx1)   09124 Replication and repair    03420 Nucleotide excision repair     116065292 (rbx1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     116065292 (rbx1)    04350 TGF-beta signaling pathway     116065292 (rbx1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     116065292 (rbx1)    04114 Oocyte meiosis     116065292 (rbx1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:sluc04121]     116065292 (rbx1)    03400 DNA repair and recombination proteins [BR:sluc03400]     116065292 (rbx1) Enzymes [BR:sluc01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      116065292 (rbx1) Ubiquitin system [BR:sluc04121]  Ubiquitin ligases (E3)   UBL E3 ligases    116065292 (rbx1)   Multi subunit type E3    SCF complex     Ring finger protein      116065292 (rbx1)    Cul2 complex      116065292 (rbx1)    Cul3 complex      116065292 (rbx1)    Cul4 complex      116065292 (rbx1)    Cul7 complex      116065292 (rbx1)    Cul8 complex      116065292 (rbx1)    Cul9 complex      116065292 (rbx1) DNA repair and recombination proteins [BR:sluc03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       116065292 (rbx1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       116065292 (rbx1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  116065292 NCBI-ProteinID:  XP_031176596 Ensembl:  ENSSLUG00000001701 UniProt:  A0A8C9X2A9 LinkDB All DBs Position 21:complement(16754823..16758130) Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcagcagctatggatgtagatacgccaagcggcacaaacagtggagctagcaaaaag cgatttgaagtaaagaagtggaatgctgtggcactgtgggcctgggacattgtggtggat aactgtgctatctgtcggaaccacatcatggatctctgtatagagtgccaggccaaccaa gcttctgcaacctctgaggagtgcactgtagcctggggtgtctgcaaccatgccttccat ttccactgtatttcccgctggctgaaaaccagacaggtgtgccctctggacaacagggag tgggagtttcagaaatacggacactag

DBGET integrated database retrieval system