Solanum lycopersicum (tomato): 101249890 Help Entry 101249890         CDS       T02665                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism sly  Solanum lycopersicum (tomato) Pathway sly03420   Nucleotide excision repair sly04120   Ubiquitin mediated proteolysis sly04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:sly00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     101249890    04120 Ubiquitin mediated proteolysis     101249890   09124 Replication and repair    03420 Nucleotide excision repair     101249890  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:sly04121]     101249890    03400 DNA repair and recombination proteins [BR:sly03400]     101249890 Enzymes [BR:sly01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      101249890 Ubiquitin system [BR:sly04121]  Ubiquitin ligases (E3)   UBL E3 ligases    101249890   Multi subunit type E3    SCF complex     Ring finger protein      101249890    Cul2 complex      101249890    Cul3 complex      101249890    Cul4 complex      101249890    Cul7 complex      101249890    Cul8 complex      101249890    Cul9 complex      101249890 DNA repair and recombination proteins [BR:sly03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       101249890     TCR (transcription coupled repair) factors      Cul4-CSA complex       101249890 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  101249890 NCBI-ProteinID:  XP_004251691 UniProt:  A0A3Q7JS26 LinkDB All DBs Position 12:2863675..2866935 Genome browser AA seq 116 aa AA seqDB search MASPDTDVPMVPAGESSTGAGTSNKKPKRFEIKKWNAVSLWAWDIVVDNCAICRNHIMDL CIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggcgtcaccggataccgatgtgccgatggttcccgccggcgagagttcaaccggagct ggaacgtctaacaaaaagccgaagcgatttgagatcaaaaagtggaacgccgtttctctc tgggcttgggatattgtggtagataattgtgccatctgtaggaatcacatcatggatctg tgtatcgagtgtcaagctaatcaagctagcgcaacaagtgaggaatgcacagttgcttgg ggtgtttgcaaccatgcattccacttccattgcattagcaggtggctcaagactcgtcaa gtgtgtccacttgataacagcgagtgggagtttcagaagtatggtcactag

DBGET integrated database retrieval system