Solanum lycopersicum (tomato): 101259644 Help Entry 101259644         CDS       T02665                                  Name (RefSeq) uncharacterized protein   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism sly  Solanum lycopersicum (tomato) Pathway sly03420   Nucleotide excision repair sly04120   Ubiquitin mediated proteolysis sly04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:sly00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     101259644    04120 Ubiquitin mediated proteolysis     101259644   09124 Replication and repair    03420 Nucleotide excision repair     101259644  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:sly04121]     101259644    03400 DNA repair and recombination proteins [BR:sly03400]     101259644 Enzymes [BR:sly01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      101259644 Ubiquitin system [BR:sly04121]  Ubiquitin ligases (E3)   UBL E3 ligases    101259644   Multi subunit type E3    SCF complex     Ring finger protein      101259644    Cul2 complex      101259644    Cul3 complex      101259644    Cul4 complex      101259644    Cul7 complex      101259644    Cul8 complex      101259644    Cul9 complex      101259644 DNA repair and recombination proteins [BR:sly03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       101259644     TCR (transcription coupled repair) factors      Cul4-CSA complex       101259644 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_11 Motif Other DBs NCBI-GeneID:  101259644 NCBI-ProteinID:  XP_004241938 UniProt:  A0A3Q7HRF6 LinkDB All DBs Position 6:42188123..42191455 Genome browser AA seq 118 aa AA seqDB search MSTDVEMAAADEGSTVTAPPCCSSSSKKPKRFEIKKWNAVSLWAWDIVVDNCAICRNHIM DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atgtctacagacgtcgagatggctgccgccgatgaaggatccaccgttaccgcacctcca tgctgttcttcttcttcgaagaaacccaagcgttttgagatcaaaaagtggaacgctgtc tctttatgggcttgggatattgttgtagacaactgtgctatttgcaggaaccatatcatg gatctctgcattgaatgtcaagctaatcaagctagtgctactagcgaggagtgcactgtt gcctggggtgtatgtaatcatgccttccactttcactgcatcagtcggtggctcaagacc cgtcaagtgtgcccattagataacagtgagtgggagtttcagaagtatggtcactag

DBGET integrated database retrieval system