Solanum lycopersicum (tomato): 778289 Help Entry 778289            CDS       T02665                                  Symbol RAN1 Name (RefSeq) GTP-binding nuclear protein Ran1   KO K07936   GTP-binding nuclear protein Ran Organism sly  Solanum lycopersicum (tomato) Pathway sly03008   Ribosome biogenesis in eukaryotes sly03013   Nucleocytoplasmic transport sly03250   Viral life cycle - HIV-1 Brite KEGG Orthology (KO) [BR:sly00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     778289 (RAN1)    03008 Ribosome biogenesis in eukaryotes     778289 (RAN1)   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     778289 (RAN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:sly03019]     778289 (RAN1)    03009 Ribosome biogenesis [BR:sly03009]     778289 (RAN1)    03016 Transfer RNA biogenesis [BR:sly03016]     778289 (RAN1)    03036 Chromosome and associated proteins [BR:sly03036]     778289 (RAN1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sly04147]     778289 (RAN1)    04031 GTP-binding proteins [BR:sly04031]     778289 (RAN1) Messenger RNA biogenesis [BR:sly03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      778289 (RAN1) Ribosome biogenesis [BR:sly03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     778289 (RAN1)   Pre-60S particles     778289 (RAN1) Transfer RNA biogenesis [BR:sly03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     778289 (RAN1) Chromosome and associated proteins [BR:sly03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      778289 (RAN1)    Spindle formation proteins     778289 (RAN1) Exosome [BR:sly04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    778289 (RAN1) GTP-binding proteins [BR:sly04031]  Small (monomeric) G-proteins   Ran Family    Ran     778289 (RAN1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf RNA_helicase MMR_HSR1 GTP_EFTU Pox_A32 ATPase AAA_24 ArgoMid Septin AAA_22 AAA_7 AAA_16 Motif Other DBs NCBI-GeneID:  778289 NCBI-ProteinID:  NP_001234016 UniProt:  P38546 LinkDB All DBs Position 5:32116351..32119931 Genome browser AA seq 221 aa AA seqDB search MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCG KIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDGNLHFV ESPALAPPEVHIDLAAQALHEEELQQAANQPLPDDDDEAFE NT seq 666 nt NT seq  +upstreamnt  +downstreamnt atggctttaccaaaccagcaaactgtagactatccaagcttcaagcttgttattgtggga gatggaggaactggcaagacaacatttgtcaaaaggcatctcactggtgaattcgagaaa aaatacgaacccactattggtgtggaggttcatccactagacttcttcacaaattgtggg aagattcggttttattgctgggatacagctggacaagagaagtttggaggtctcagagat ggttactacattcatgggcaatgtgcaattatcatgtttgatgttacagcccgtctgacc tacaagaatgttcctacatggcatagagatctttgtagggtttgtgaaaacatccccatt gttctctgtggaaacaaagttgatgtcaagaacaggcaggttaaggctaagcaagttacc ttccacaggaagaaaaatttgcaatactatgagatctcagcaaagagtaactacaacttt gagaagccttttctgtaccttgccagaaagcttgctggggatggtaatcttcactttgtg gagtcacctgcacttgctcccccagaagtacacatcgacttagctgcacaggcactgcat gaagaagagcttcaacaagccgccaatcagccacttccagatgacgatgacgaagcattt gaatag

DBGET integrated database retrieval system