Serratia sp. FGI94: D781_4017 Help Entry D781_4017         CDS       T02433                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism smaf  Serratia sp. FGI94 Pathway smaf00790   Folate biosynthesis smaf01100   Metabolic pathways smaf01240   Biosynthesis of cofactors Module smaf_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:smaf00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     D781_4017 Enzymes [BR:smaf01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      D781_4017  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      D781_4017  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      D781_4017 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AGB84207 UniProt:  L0MLK0 LinkDB All DBs Position complement(4246711..4247070) Genome browser AA seq 119 aa AA seqDB search MDIVFIEELTVIATIGVYDWEQTIRQKLVFDIEMGWDNRKAAASDDVNDCLSYADISEAV IQHVESGRFALVERVAEEISEILLQRFKSPWVRIKVSKPGAVAQASRVGVVIERGRRPA NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatatcgtatttattgaggaacttaccgtaatcgccaccattggcgtttatgattgg gaacaaacgattcgccagaaactggtgttcgatatcgaaatgggctgggataaccgcaag gcggccgccagcgatgacgtcaacgactgtttgagctatgccgatatcagcgaagcggtg attcaacacgttgaatccgggcgctttgcgctggtagagcgtgttgctgaggaaatatcc gaaatattgctccagcgctttaaatccccatgggtccgtattaaggtcagcaagccgggc gcggtggcgcaggccagccgggttggcgtcgtgatcgaacgaggccggcgtccggcgtga

DBGET integrated database retrieval system