Scophthalmus maximus (turbot): 118314704 Help Entry 118314704         CDS       T09850                                  Symbol tmem258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism smau  Scophthalmus maximus (turbot) Pathway smau00510   N-Glycan biosynthesis smau00513   Various types of N-glycan biosynthesis smau04141   Protein processing in endoplasmic reticulum Module smau_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:smau00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     118314704 (tmem258)    00513 Various types of N-glycan biosynthesis     118314704 (tmem258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     118314704 (tmem258) SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 TctB Motif Other DBs NCBI-GeneID:  118314704 NCBI-ProteinID:  XP_035497180 LinkDB All DBs Position 7:13112259..13114627 Genome browser AA seq 79 aa AA seqDB search MELEAMTRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDVYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaactcgaggccatgaccagatacaccagcccggtgaacccggctgtgttcccccac ctcacggtggtcctgctggccatcggcatgttcttcaccgcctggttcttcgtctatgag gtgacttcaacaaaatacaccagggacgtctacaaagagctgctgatctccctcgtcgct tcacttttcatgggcttcggagtgctgttcctgctactttgggttggaatatacgtttga

DBGET integrated database retrieval system