Silurus meridionalis (southern catfish): 124381909 Help Entry 124381909         CDS       T08004                                  Symbol rbx1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism smeo  Silurus meridionalis (southern catfish) Pathway smeo03420   Nucleotide excision repair smeo04110   Cell cycle smeo04114   Oocyte meiosis smeo04120   Ubiquitin mediated proteolysis smeo04141   Protein processing in endoplasmic reticulum smeo04310   Wnt signaling pathway smeo04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:smeo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     124381909 (rbx1)    04120 Ubiquitin mediated proteolysis     124381909 (rbx1)   09124 Replication and repair    03420 Nucleotide excision repair     124381909 (rbx1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     124381909 (rbx1)    04350 TGF-beta signaling pathway     124381909 (rbx1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     124381909 (rbx1)    04114 Oocyte meiosis     124381909 (rbx1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:smeo04121]     124381909 (rbx1)    03400 DNA repair and recombination proteins [BR:smeo03400]     124381909 (rbx1) Enzymes [BR:smeo01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      124381909 (rbx1) Ubiquitin system [BR:smeo04121]  Ubiquitin ligases (E3)   UBL E3 ligases    124381909 (rbx1)   Multi subunit type E3    SCF complex     Ring finger protein      124381909 (rbx1)    Cul2 complex      124381909 (rbx1)    Cul3 complex      124381909 (rbx1)    Cul4 complex      124381909 (rbx1)    Cul7 complex      124381909 (rbx1)    Cul8 complex      124381909 (rbx1)    Cul9 complex      124381909 (rbx1) DNA repair and recombination proteins [BR:smeo03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       124381909 (rbx1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       124381909 (rbx1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  124381909 NCBI-ProteinID:  XP_046699798 LinkDB All DBs Position 29:complement(12012971..12015888) Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggccgcgatggatgtcgacaccccgagcgggacgaacagcggggccagtaagaag cgatttgaagtgaaaaagtggaacgctgtagctctgtgggcctgggacatcgtagtggac aactgcgccatctgcaggaaccacatcatggacctctgtattgagtgtcaggccaaccag gcttctgccacatcagaggagtgcacagtggcctggggagtctgtaatcatgcatttcat ttccactgcatctctcgctggctgaagacgaggcaggtgtgtcctctggataacagggag tgggagttccagaagtacggacactga

DBGET integrated database retrieval system