Silurus meridionalis (southern catfish): 124391650 Help Entry 124391650         CDS       T08004                                  Symbol pole4 Name (RefSeq) DNA polymerase epsilon subunit 4   KO K03506   DNA polymerase epsilon subunit 4 [EC:2.7.7.7] Organism smeo  Silurus meridionalis (southern catfish) Pathway smeo03030   DNA replication smeo03410   Base excision repair smeo03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:smeo00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     124391650 (pole4)    03410 Base excision repair     124391650 (pole4)    03420 Nucleotide excision repair     124391650 (pole4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:smeo03032]     124391650 (pole4)    03400 DNA repair and recombination proteins [BR:smeo03400]     124391650 (pole4) Enzymes [BR:smeo01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      124391650 (pole4) DNA replication proteins [BR:smeo03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     124391650 (pole4) DNA repair and recombination proteins [BR:smeo03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       124391650 (pole4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C TAF TFIID-31kDa Motif Other DBs NCBI-GeneID:  124391650 NCBI-ProteinID:  XP_046714306 LinkDB All DBs Position 9:complement(26793473..26796574) Genome browser AA seq 125 aa AA seqDB search MATGVGASVSSSEPEFERTEGEMRGTDPEEENSAHTGPVPGPQHRLAKLPLSRIKALMKA DPDLSLASQESVFIIAKATELFVEMIAKDALVYAQQGKRKTLQRKDLDNAIEAADEFAFL EGTLD NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atggctacaggagtaggggcgagtgtttcctcctcagagccggagtttgaacgaactgaa ggggaaatgcgggggactgatcccgaggaggagaacagcgcacacaccggccctgtcccc ggccctcaacaccgcctcgctaaattacccctgtcccgcattaaagccctcatgaaggcg gacccggacctgagcctggccagtcaggaatctgtgtttatcatagctaaagccacggag ctgtttgtggaaatgattgccaaggatgcacttgtttatgcacagcaaggaaaaaggaaa accctgcagaggaaagatctggacaatgccattgaagcagcagatgagtttgcgtttctt gagggtaccttggactaa

DBGET integrated database retrieval system