Silurus meridionalis (southern catfish): 124391916 Help Entry 124391916         CDS       T08004                                  Symbol tmem258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism smeo  Silurus meridionalis (southern catfish) Pathway smeo00510   N-Glycan biosynthesis smeo00513   Various types of N-glycan biosynthesis smeo04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:smeo00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     124391916 (tmem258)    00513 Various types of N-glycan biosynthesis     124391916 (tmem258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     124391916 (tmem258) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 TctB Motif Other DBs NCBI-GeneID:  124391916 NCBI-ProteinID:  XP_046714571 LinkDB All DBs Position 10:1404101..1405720 Genome browser AA seq 79 aa AA seqDB search MELEAMTRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDVYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctggaggccatgaccagatacacgagtccggtgaacccggctgtgtttcctcac ctcaccgtggtgctgctcgcgatcggcatgttcttcacagcgtggttcttcgtctatgag gtgacctccacaaaatacacacgagacgtctacaaggagctgctcatctcgctggtcgca tcactcttcatgggcttcggcgttctcttcctgctgctttgggtcggaatctacgtttga

DBGET integrated database retrieval system