Salvia miltiorrhiza (redroot sage): 130987662 Help Entry 130987662         CDS       T09291                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism smil  Salvia miltiorrhiza (redroot sage) Pathway smil03420   Nucleotide excision repair smil04120   Ubiquitin mediated proteolysis smil04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:smil00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     130987662    04120 Ubiquitin mediated proteolysis     130987662   09124 Replication and repair    03420 Nucleotide excision repair     130987662  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:smil04121]     130987662    03400 DNA repair and recombination proteins [BR:smil03400]     130987662 Enzymes [BR:smil01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      130987662 Ubiquitin system [BR:smil04121]  Ubiquitin ligases (E3)   UBL E3 ligases    130987662   Multi subunit type E3    SCF complex     Ring finger protein      130987662    Cul2 complex      130987662    Cul3 complex      130987662    Cul4 complex      130987662    Cul7 complex      130987662    Cul8 complex      130987662    Cul9 complex      130987662 DNA repair and recombination proteins [BR:smil03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       130987662     TCR (transcription coupled repair) factors      Cul4-CSA complex       130987662 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  130987662 NCBI-ProteinID:  XP_057767255 LinkDB All DBs Position 1:47160958..47163601 Genome browser AA seq 125 aa AA seqDB search MATLDTDVNMVPAGEGSSGAGPSNTTPQPPQSSKKSKKFEIKKWNAVSLWAWDIVVDNCA ICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEF QKYGH NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atggcgacgctcgacaccgacgtcaacatggttccggctggagagggctcatccggcgcc ggcccttccaacaccacgccacagccgccgcagtcctccaaaaaatccaagaaatttgag attaaaaagtggaacgccgtctcgctctgggcttgggatatcgtggtcgataattgtgct atttgcaggaaccatataatggatctatgcatcgagtgccaagctaatcaagctagtgcg acgagcgaggaatgcacggttgcttggggggtttgcaaccatgctttccacttccattgc atcagcaggtggcttaagactcgccaagtttgccccctcgataacagtgagtgggagttt cagaagtatggccactag

DBGET integrated database retrieval system