Salvia miltiorrhiza (redroot sage): 131021462 Help Entry 131021462         CDS       T09291                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism smil  Salvia miltiorrhiza (redroot sage) Pathway smil03420   Nucleotide excision repair smil04120   Ubiquitin mediated proteolysis smil04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:smil00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     131021462    04120 Ubiquitin mediated proteolysis     131021462   09124 Replication and repair    03420 Nucleotide excision repair     131021462  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:smil04121]     131021462    03400 DNA repair and recombination proteins [BR:smil03400]     131021462 Enzymes [BR:smil01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      131021462 Ubiquitin system [BR:smil04121]  Ubiquitin ligases (E3)   UBL E3 ligases    131021462   Multi subunit type E3    SCF complex     Ring finger protein      131021462    Cul2 complex      131021462    Cul3 complex      131021462    Cul4 complex      131021462    Cul7 complex      131021462    Cul8 complex      131021462    Cul9 complex      131021462 DNA repair and recombination proteins [BR:smil03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       131021462     TCR (transcription coupled repair) factors      Cul4-CSA complex       131021462 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  131021462 NCBI-ProteinID:  XP_057806638 LinkDB All DBs Position 4:complement(37552300..37556421) Genome browser AA seq 123 aa AA seqDB search MASLDTDVNMVPAGDGSSGAGPSTINPSSSTKKPKRFEIKKWNAVSLWAWDIVVDNCAIC RNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQK YGH NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atggcctcacttgataccgacgtcaatatggttcccgccggcgatggatcctccggcgcc gggccctccaccatcaatccctcatcgtccaccaagaaacccaagcgattcgagattaaa aagtggaacgccgtctccctctgggcttgggatatcgtggtcgacaattgtgctatttgc agaaatcatatcatggatctatgcatcgagtgtcaggctaatcaggccagcgcaacaagc gaggaatgcacagttgcatggggtgtttgcaatcatgccttccacttccattgcattagc agatggctcaagactcgtcaagtttgccctctggataacagcgagtgggagtttcagaag tatggtcactag

DBGET integrated database retrieval system