Selaginella moellendorffii: SELMODRAFT_269937 Help Entry SELMODRAFT_269937 CDS       T01496                                  Name (RefSeq) hypothetical protein   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism smo  Selaginella moellendorffii Pathway smo03420   Nucleotide excision repair smo04120   Ubiquitin mediated proteolysis smo04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:smo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     SELMODRAFT_269937    04120 Ubiquitin mediated proteolysis     SELMODRAFT_269937   09124 Replication and repair    03420 Nucleotide excision repair     SELMODRAFT_269937  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:smo04121]     SELMODRAFT_269937    03400 DNA repair and recombination proteins [BR:smo03400]     SELMODRAFT_269937 Enzymes [BR:smo01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      SELMODRAFT_269937 Ubiquitin system [BR:smo04121]  Ubiquitin ligases (E3)   UBL E3 ligases    SELMODRAFT_269937   Multi subunit type E3    SCF complex     Ring finger protein      SELMODRAFT_269937    Cul2 complex      SELMODRAFT_269937    Cul3 complex      SELMODRAFT_269937    Cul4 complex      SELMODRAFT_269937    Cul7 complex      SELMODRAFT_269937    Cul8 complex      SELMODRAFT_269937    Cul9 complex      SELMODRAFT_269937 DNA repair and recombination proteins [BR:smo03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       SELMODRAFT_269937     TCR (transcription coupled repair) factors      Cul4-CSA complex       SELMODRAFT_269937 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 Motif Other DBs NCBI-GeneID:  9629202 NCBI-ProteinID:  XP_002992487 JGI:  269937 UniProt:  D8TA94 LinkDB All DBs Position Unknown AA seq 117 aa AA seqDB search MASVDMMDVAGPSGEGSSSGASSSAKRSKRFEIKKWNAVALWAWDIVVDNCAICRNHIMD LCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGR NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggcgagcgtcgacatgatggatgtggccgggccatcgggcgagggctccagcagcggc gcgagtagctccgccaagcgctctaagcgcttcgagatcaagaagtggaacgctgtggcg ctttgggcatgggacattgtggtggacaactgcgcgatttgccggaatcacatcatggat ctgtgcatcgagtgccaggcaaaccaggccagcgccacgagcgaagaatgcaccgttgcc tggggcgtgtgcaaccatgcgtttcacttccactgcatcagccgctggctaaagactcgc caagtctgccctctcgataacagcgagtgggagttccagaaatacggtcgctag

DBGET integrated database retrieval system