KEGG   Sulfurospirillum multivorans: SMUL_1531
Entry
SMUL_1531         CDS       T03049                                 

Gene name
pceA
Definition
(GenBank) tetrachloroethene reductive dehalogenase catalytic subunit PceA
  KO
K21647  tetrachloroethene reductive dehalogenase [EC:1.21.99.5]
Organism
smul  Sulfurospirillum multivorans
Pathway
smul00625  Chloroalkane and chloroalkene degradation
smul01100  Metabolic pathways
smul01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smul00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SMUL_1531 (pceA)
Enzymes [BR:smul01000]
 1. Oxidoreductases
  1.21  Catalysing the reaction X-H + Y-H = X-Y
   1.21.99  With unknown physiological acceptors
    1.21.99.5  tetrachloroethene reductive dehalogenase
     SMUL_1531 (pceA)
SSDB
Motif
Pfam: Dehalogenase Fer4_16 Fer4_7 Fer4_10 Fer4_6 Fer4 Fer4_2 Fer4_4 Fer4_8
Other DBs
NCBI-ProteinID: AHJ12791
LinkDB
Structure
PDB: 

Position
1491311..1492816
AA seq 501 aa
MEKKKKPELSRRDFGKLIIGGGAAVTIAPFGVPGANAAEKEKNAAEIRQQFAMTAGSPII
VNDKLERYAEVRTAFTHPTSFFKPNYKGEVKPWFLSAYDEKVRQIENGENGPKMKAKNVG
EARAGRALEAAGWTLDINYGNIYPNRFFMLWSGETMTNTQLWAPVGLDRRPPDTTDPVEL
TNYVKFAARMAGADLVGVARLNRNWVYSEAVTIPADVPYEQSLHKEIEKPIVFKDVPLPI
ETDDELIIPNTCENVIVAGIAMNREMMQTAPNSMACATTAFCYSRMCMFDMWLCQFIRYM
GYYAIPSCNGVGQSVAFAVEAGLGQASRMGACITPEFGPNVRLTKVFTNMPLVPDKPIDF
GVTEFCETCKKCARECPSKAITEGPRTFEGRSIHNQSGKLQWQNDYNKCLGYWPESGGYC
GVCVAVCPFTKGNIWIHDGVEWLIDNTRFLDPLMLGMDDALGYGAKRNITEVWDGKINTY
GLDADHFRDTVSFRKDRVKKS
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggaaaagaaaaaaaagcctgaactctcaagaagagattttggtaagttgattatcgga
ggtggagctgcagtaacgatagctccatttggtgtaccaggtgcaaatgcagctgaaaaa
gagaaaaatgcagctgaaattcgtcaacaatttgcaatgactgcaggttctcccatcata
gttaacgacaaattggaaagatatgctgaagtacgaacagcgtttactcatccaacctca
ttttttaaaccaaactacaaaggtgaagtgaaaccttggtttttatcagcatatgatgag
aaagtacgtcagattgaaaatggtgaaaatggtcctaagatgaaagctaaaaatgtagga
gaagctagagcaggtcgtgcacttgaagctgctggatggaccttagatattaactatgga
aacatttatccaaatagattttttatgttatggtctggtgagactatgactaacacccaa
ttgtgggcaccagtagggttagatagaagacctccagatacaactgatcctgtggaactt
acaaattatgtaaaatttgctgcacgtatggcaggtgctgatttggtaggtgttgcaaga
ttaaatcgtaactgggtttattctgaggcagtaactataccagctgacgtaccttatgaa
caatctttgcataaagagattgaaaagccaatcgttttcaaagatgttccactaccaata
gaaactgatgatgaattaattatccctaatacttgtgaaaatgttatcgttgcaggtatc
gctatgaaccgcgaaatgatgcaaacagctcctaacagtatggcatgtgcaacaacagca
ttttgttattcacgtatgtgtatgttcgatatgtggttatgccagtttattcgttatatg
ggttactatgcaataccaagctgtaatggtgttggacaatcagttgcctttgctgttgaa
gcaggtttaggacaagctagtcgtatgggtgcttgtattactcctgaatttggaccaaac
gtaagacttacaaaagtctttacaaatatgcctttagttccagataagcctatcgacttt
ggagtaacagaattttgtgaaacatgtaaaaaatgtgcacgtgagtgtccttcaaaagca
attactgaaggtccaagaacttttgaaggacgaagtattcataatcaatcaggtaaatta
cagtggcaaaatgactataataaatgcttaggttattggccggaatctggtggatattgt
ggcgtatgtgtagctgtttgcccctttacaaaaggcaatatttggattcatgatggcgtt
gaatggcttattgataacacaagattcttagacccattaatgcttggtatggatgatgca
ttgggctatggtgcaaaacgaaatattacagaagtttgggatggaaagattaatacatat
ggtctagacgcagaccattttagagacactgtaagctttagaaaggatagggttaaaaaa
tcatga

DBGET integrated database retrieval system