Stenotrophomonas maltophilia D457: SMD_2722
Help
Entry
SMD_2722 CDS
T02061
Symbol
ligA
Name
(GenBank) DNA ligase
KO
K01972
DNA ligase (NAD+) [EC:
6.5.1.2
]
Organism
smz
Stenotrophomonas maltophilia D457
Pathway
smz03030
DNA replication
smz03410
Base excision repair
smz03420
Nucleotide excision repair
smz03430
Mismatch repair
Brite
KEGG Orthology (KO) [BR:
smz00001
]
09120 Genetic Information Processing
09124 Replication and repair
03030 DNA replication
SMD_2722 (ligA)
03410 Base excision repair
SMD_2722 (ligA)
03420 Nucleotide excision repair
SMD_2722 (ligA)
03430 Mismatch repair
SMD_2722 (ligA)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03032 DNA replication proteins [BR:
smz03032
]
SMD_2722 (ligA)
03400 DNA repair and recombination proteins [BR:
smz03400
]
SMD_2722 (ligA)
Enzymes [BR:
smz01000
]
6. Ligases
6.5 Forming phosphoric-ester bonds
6.5.1 Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
6.5.1.2 DNA ligase (NAD+)
SMD_2722 (ligA)
DNA replication proteins [BR:
smz03032
]
Prokaryotic type
DNA Replication Elongation Factors
Elongation factors (bacterial)
Other elongation factors
SMD_2722 (ligA)
DNA repair and recombination proteins [BR:
smz03400
]
Prokaryotic type
SSBR (single strand breaks repair)
BER (base exicision repair)
DNA ligase
SMD_2722 (ligA)
NER (nucleotide excision repair)
GGR (global genome repair) factors
SMD_2722 (ligA)
MMR (mismatch excision repair)
DNA ligase
SMD_2722 (ligA)
DSBR (double strand breaks repair)
NHEJ (non-homologous end-joining)
SHDIR (short-homology-dependent illegitimate recombination)
RecET pathway
SMD_2722 (ligA)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
DNA_ligase_aden
DNA_ligase_OB
HHH_2
BRCT
DNA_ligase_ZBD
HHH_5
Nlig-Ia
PTCB-BRCT
Motif
Other DBs
NCBI-ProteinID:
CCH13252
LinkDB
All DBs
Position
complement(3029251..3031716)
Genome browser
AA seq
821 aa
AA seq
DB search
MSPSPAERAEDLRRQIAQANRAYHELDAPEIPDVDYDRMVRELEALEREHPELARADSPT
QQVGARPSGRFPEVRHAVPMLSLSNAFSDEEVADFVRRIDERLGRRSLQFSAEPKMDGLA
ISLRYEDGHFVLGATRGDGSTGEDVTANLREIGDVPKRLHGKDWPDVLEVRGEVYMARAD
FEAYNERARQQGGKVLANPRNAAAGSLRQLDPKISAQRRLSFFAYGTGEVQGGELPDTHS
GTLAQLGAWGFPVSGLCKVVQGADGLLGYYRDIGERRDGLPFDIDGVVYKLDDRAGQQAM
GFVSRAPRWAIAHKFPAQEQSTTVEAIEIQIGRTGAATPVARLAPVAVAGVIVSNATLHN
ADQIARLDVRVGDSVIVRRAGDVIPEVVSVILDRRPQGASPWQMPTRCPVCGSEIVREEG
AAAWRCSGELSCPAQRKEAIAHFASRRAMDIDGLGDKYIETLVDAGIVRSVADLYRLNRD
QLLHLKLVLDAEDPSALAATLKLHLPAEGSGAVLNAVLKLDGNDPAWRAQALAQPASFEW
NTKKIATRWADNLIAAIDASRAATLERLLFALGIEHVGESTAKALAQWFGDLELIRHLPW
PLFKRVPDIGGEVARSLGHFFEQQGNQQAIDDLLQVGQVRISDVHAPSAKLREGLDLAQL
LVESEIPGITRLRAEKLVAALPGAQAVLDAEHGQFVNAGLPDDTARGLADWLDADGHGAM
LLAAEKAMQQILAKAPALAEIVAGPLDGQTVVLTGTLAQLTRDAAKERLEALGAKVSGSV
SKKTSFVVAGTEAGSKLDKAQSLGVPVWDEDRLLAYLAEHE
NT seq
2466 nt
NT seq
+upstream
nt +downstream
nt
atgagccccagccccgccgaacgcgccgaagatctccgccggcagatcgcccaggccaac
cgcgcctaccacgagctggacgcgccggagatccccgacgtcgactacgaccggatggtg
cgcgagctggaagcgttggagcgcgagcacccggagctggcccgtgccgacagcccgacc
caacaggtcggtgcacgcccgtccggccgcttccccgaagtgcgccatgcggtgccgatg
ctgtcgctgtccaatgccttcagcgatgaggaagtggccgacttcgtgcgccgcatcgat
gagcgcctgggccgccgcagcctgcagttctcggccgaaccgaagatggatggcctggcg
atcagcctgcgctacgaggacggtcatttcgtactcggcgcaacccgcggtgatggcagt
accggcgaggacgtgaccgccaacctgcgtgaaatcggcgatgttcccaagcgcctgcac
ggcaaggactggccggatgtgctggaggtgcgtggcgaggtgtacatggcccgcgccgac
ttcgaggcctacaacgaacgtgcgcgccagcagggcggcaaggtgctggccaacccgcgc
aacgcggcagcgggttcactgcgccagctcgatccgaagatcagtgcgcagcgccggctg
agtttcttcgcctacggcaccggtgaagtgcagggcggcgagctgccggacacccattcg
ggcacgctggcccagctcggcgcctggggcttcccggtcagcgggttgtgcaaggtggtg
caaggcgccgacggcctgctcggctactaccgtgacatcggcgagcgtcgcgatggcctg
ccgttcgacatcgatggtgtggtctacaagctggatgaccgcgccggccagcaggccatg
gggtttgtctcgcgtgcgccacgctgggccatcgcgcacaagttcccggcacaggaacag
agcaccacggtggaggcgatcgagatccagatcggccgcaccggtgccgccacgccggtc
gcgcggctggcaccggtggctgtggccggcgtgatcgtgtccaatgccacgttgcacaat
gccgatcagatcgcgcgtctcgatgtgcgtgtcggtgacagcgtgatcgtgcgacgtgct
ggcgacgtgattccggaagtggtcagcgtcatcctcgaccgccgtccacagggcgcctcg
ccctggcagatgccgacgcgctgcccggtgtgcggctcggaaatcgtgcgcgaggaaggt
gcagccgcgtggcgctgttcgggcgaactgtcctgcccggcgcagcgcaaggaggccatt
gcccatttcgcttcgcgccgtgcgatggatatcgacggcctcggcgacaagtacatcgaa
accctggtcgacgccggcatcgtcaggagcgtggctgatctgtaccggctcaaccgtgac
cagctgttgcacctgaagctggtgctggatgccgaggacccttccgcactggccgccacg
ctgaagctgcacctgccggcagaaggcagcggcgcggtgctcaatgcggtgctcaagctg
gatggcaacgatccggcgtggcgcgcgcaggcgctggcacagccggccagcttcgaatgg
aacacgaagaagatcgccaccagatgggccgacaacctgatcgcggcaatcgacgccagt
cgcgcagccacgctggagcgcctgctgttcgcgcttggcatcgagcacgtcggcgagagc
acggccaaggcgctggcgcagtggttcggtgacctggaactgatccgccacctgccatgg
ccgttgttcaagcgcgtgccggacatcggtggcgaagtggcgcgttctctcggccatttc
ttcgagcagcagggcaaccagcaggccatcgacgacctgctgcaggtcgggcaggtgcgc
atcagtgatgtgcacgcgcccagtgccaagctgcgcgaaggcctggatctggcgcaactg
ctggtcgaatcggaaatccccggcatcacccgcctgcgtgcggagaagctggtggctgcc
ttgccgggtgcccaggcggtgctggatgccgagcatggccagttcgtcaacgccggcctg
ccggacgacactgcgcgcggtctggccgactggctcgatgccgatggccatggcgcgatg
ctgctggcagccgagaaggcgatgcagcagatcctggccaaggcgccggcgctggccgag
atcgtggccggcccgctggatgggcagaccgtggtgctgaccggcaccctggcccagctc
acccgcgatgccgccaaggaacgcctggaagcgctgggtgccaaggtctccggcagcgtg
tcgaagaagaccagcttcgtggtcgccggcaccgaggccggctccaagctggacaaggcg
caatcgctgggcgtgccggtgtgggacgaagaccgcctgctggcctacctcgccgaacac
gaatga
DBGET
integrated database retrieval system