Salvelinus namaycush (lake trout): 120034372 Help Entry 120034372         CDS       T07522                                  Name (RefSeq) RING-box protein 1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism snh  Salvelinus namaycush (lake trout) Pathway snh03420   Nucleotide excision repair snh04110   Cell cycle snh04114   Oocyte meiosis snh04120   Ubiquitin mediated proteolysis snh04141   Protein processing in endoplasmic reticulum snh04310   Wnt signaling pathway snh04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:snh00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     120034372    04120 Ubiquitin mediated proteolysis     120034372   09124 Replication and repair    03420 Nucleotide excision repair     120034372  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     120034372    04350 TGF-beta signaling pathway     120034372  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     120034372    04114 Oocyte meiosis     120034372  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:snh04121]     120034372    03400 DNA repair and recombination proteins [BR:snh03400]     120034372 Enzymes [BR:snh01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      120034372 Ubiquitin system [BR:snh04121]  Ubiquitin ligases (E3)   UBL E3 ligases    120034372   Multi subunit type E3    SCF complex     Ring finger protein      120034372    Cul2 complex      120034372    Cul3 complex      120034372    Cul4 complex      120034372    Cul7 complex      120034372    Cul8 complex      120034372    Cul9 complex      120034372 DNA repair and recombination proteins [BR:snh03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       120034372     TCR (transcription coupled repair) factors      Cul4-CSA complex       120034372 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  120034372 NCBI-ProteinID:  XP_038836829 UniProt:  A0A8U0U1E6 LinkDB All DBs Position Sna41:complement(11299797..11303671) Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPSATNSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggcagcgatggatgttgatacgccaagcgccacgaatagtggagcaagcaagaaa cgttttgaagtgaagaagtggaatgcagtggcactttgggcctgggacattgtggtggac aactgtgccatctgtaggaatcacattatggatctctgcatagagtgccaggctaaccag gcctctgccacatcagaggagtgcaccgtagcctggggagtctgcaatcatgcattccat ttccactgtatctcccgttggttgaagaccaggcaggtgtgccccctagacaacagggag tgggagtttcagaaatatggacactag

DBGET integrated database retrieval system