Salvelinus namaycush (lake trout): 120052279 Help Entry 120052279         CDS       T07522                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism snh  Salvelinus namaycush (lake trout) Pathway snh00510   N-Glycan biosynthesis snh00513   Various types of N-glycan biosynthesis snh04141   Protein processing in endoplasmic reticulum Module snh_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:snh00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     120052279    00513 Various types of N-glycan biosynthesis     120052279  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     120052279 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 TctB Motif Other DBs NCBI-GeneID:  120052279 NCBI-ProteinID:  XP_038855033 UniProt:  A0A8U0UJL5 LinkDB All DBs Position Sna8:2075528..2079916 Genome browser AA seq 79 aa AA seqDB search MELEAMTRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDVYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctggaggcgatgaccagatacaccagtccggtgaacccggcagtcttcccccac ctcaccgtggttctactggctatcgggatgttcttcactgcgtggttctttgtctacgag gtgacatccactaaatacaccagagacgtgtacaaagagctgctcatctccctggtggcg tctctcttcatgggcttcggagtgctgtttctcttactgtgggtcggcatctatgtctga

DBGET integrated database retrieval system