Solenopsis invicta (red fire ant): 105195164 Help Entry 105195164         CDS       T03916                                  Name (RefSeq) RING-box protein 1A   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism soc  Solenopsis invicta (red fire ant) Pathway soc03420   Nucleotide excision repair soc04120   Ubiquitin mediated proteolysis soc04141   Protein processing in endoplasmic reticulum soc04310   Wnt signaling pathway soc04341   Hedgehog signaling pathway - fly soc04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:soc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     105195164    04120 Ubiquitin mediated proteolysis     105195164   09124 Replication and repair    03420 Nucleotide excision repair     105195164  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     105195164    04341 Hedgehog signaling pathway - fly     105195164    04350 TGF-beta signaling pathway     105195164  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:soc04121]     105195164    03400 DNA repair and recombination proteins [BR:soc03400]     105195164 Enzymes [BR:soc01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      105195164 Ubiquitin system [BR:soc04121]  Ubiquitin ligases (E3)   UBL E3 ligases    105195164   Multi subunit type E3    SCF complex     Ring finger protein      105195164    Cul2 complex      105195164    Cul3 complex      105195164    Cul4 complex      105195164    Cul7 complex      105195164    Cul8 complex      105195164    Cul9 complex      105195164 DNA repair and recombination proteins [BR:soc03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       105195164     TCR (transcription coupled repair) factors      Cul4-CSA complex       105195164 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 PHD_NSD Motif Other DBs NCBI-GeneID:  105195164 NCBI-ProteinID:  XP_011158745 LinkDB All DBs Position 5:21936580..21938791 Genome browser AA seq 113 aa AA seqDB search MATTMEIDDDECDLPTSSSGKGEKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIE CQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggcaacgaccatggagatcgacgatgacgagtgcgatctgccaacctccagcagcggg aaaggtgagaagaagcgtttcgaggtgaagaagtggaacgcagtggcactatgggcctgg gatattgttgtggacaattgcgctatttgtcgtaatcatatcatggatctctgcattgag tgtcaagcgaaccaggcgtctgctaccagtgaggaatgcacagtagcctggggtgtatgt aatcacgcctttcactttcactgtatctcacgttggctgaaaactcgacaagtctgtcca cttgataatcgtgaatgggaatttcagaaatatggccattaa

DBGET integrated database retrieval system